DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and sgsm3

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_998495.1 Gene:sgsm3 / 406635 ZFINID:ZDB-GENE-040426-2635 Length:755 Species:Danio rerio


Alignment Length:332 Identity:86/332 - (25%)
Similarity:159/332 - (47%) Gaps:44/332 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DEYGFKRGDHFDYNNYSKFM--DGY-LKTLTRRRMKWEAILQQNTDLTQVDA------------- 61
            ||:|| |.|..|.....|::  ||. .:...::|::|:|.|:...:.|..|.             
Zfish    43 DEFGF-RIDSEDGVETRKWLCGDGAPQREDPQQRLRWQAHLEFTHNHTVGDLTWDKITPTLARSD 106

  Fly    62 KLKRYIRKGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLR-TEPFDKEISDSISIDLPRTFPDN 125
            :|:..:..|||...||.:||::|||...:|.|...:|.::: :...|...:..|..||.||.|.|
Zfish   107 RLRSLVLGGIPHSMRPQLWMRLSGALQKKRTSDISYREIVKNSSNDDTTAAKQIEKDLLRTMPTN 171

  Fly   126 IHFD----MKKQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVENIV-P 185
            ..|:    :...:|..:|...|....|:|||||...:...||:.. :||.:.|::..::|::: |
Zfish   172 ACFNTLTSVGVPKLRRVLRGLAWLYPDIGYCQGTGMVVSCLLLFL-EEEDALWMMCALIEDLLPP 235

  Fly   186 QYHSHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWD 250
            .|.|..:..:..|..|.|:|:::.:|.:::.:....:...:|...||:..||.|:.:..:|||||
Zfish   236 SYFSSTLLGVQTDQRVLRQLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVDIRILLRIWD 300

  Fly   251 CVFAEGYKIVFRAALTMFVTHKNAILGCDDIAALANLFRD--------------------TMIQD 295
            .:|.||..::|:..|.|....::.::..::.|::.|...|                    ::.|:
Zfish   301 LLFYEGSMVLFQVTLGMLKIKEDELVSSENSASIFNTLSDLPSQLEDGAAVLGEAVRLAGSLSQE 365

  Fly   296 NIVTDCH 302
            |:.|..|
Zfish   366 NLDTHRH 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 62/214 (29%)
sgsm3NP_998495.1 TBC 112..326 CDD:214540 62/214 (29%)
SH3_SGSM3 488..540 CDD:212747
RUN 567..720 CDD:280855
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162786at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.