DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and tbc1d5

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001315187.1 Gene:tbc1d5 / 393583 ZFINID:ZDB-GENE-040426-1197 Length:863 Species:Danio rerio


Alignment Length:421 Identity:88/421 - (20%)
Similarity:148/421 - (35%) Gaps:153/421 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DVDEYGFKRGDHFDYNNYSKFMD-GYL-----KTLTRRRMKWEAILQQNTDLTQVDAKLKRYIRK 69
            |..|.|:.     ...||::..| |.|     .||...|.:|:       ||.|....|.|..:.
Zfish    15 DEQETGYD-----PLQNYNRNRDRGSLGSAVESTLQSYRKEWD-------DLFQNSNYLPRIRQA 67

  Fly    70 GIPGPYRP------------DV-------WM-----------KISGAAAAQRRSPDLFRNLLRTE 104
            ||.|..|.            ||       |:           ||........|.....::|:...
Zfish    68 GINGRLRSSRFRSVCWKLYLDVLPEDKAQWISRTKEHRAQYEKIKEMHITNPRKAAGQQDLVVNN 132

  Fly   105 PF-------------DKEISDSISIDLPRTFPDNIHFDMK--KQRLYNILIAYAHHNRDVGYCQG 154
            |.             |||:...|..|:.||||:.::|..:  :.::.:||..||..|..:.|.||
Zfish   133 PLSQDEGSLWNKFFQDKELRGMIKQDVLRTFPEMLYFQEEDVRTKMTDILFCYARENEQLLYKQG 197

  Fly   155 LNYIAGLLLIVTDDEEKSFWLLKHIVEN----------IVPQYHSHN---MANLL---------- 196
            ::.:...::.|...:.::|   :|..|.          :.|::|.|:   |.:||          
Zfish   198 MHELLAPIVFVLHCDHQAF---QHASETANPSDEMKVLLDPKFHEHDAYTMFSLLMETAEPWFSS 259

  Fly   197 --RDLAVFRELVIRRIP---------------AVNR---------------HVDNLGLPYPVIAS 229
              |::...:|.::..||               .|||               |::.|.:...:...
Zfish   260 FEREVRKGKEEMLTSIPFARPQDSGPSVAIVTKVNRIQDQLIKKHDIELYMHLNRLEIAPQIYGI 324

  Fly   230 KWFICIFAEVLPVETVLRIWDCVFAEGYKI-----VFRAALTMFVTHKNAILGCDDIAALANLFR 289
            :|...:|....|::.:|.:||.:||:...:     || .|:.:::                   |
Zfish   325 RWVRLLFGREFPLQDLLVVWDALFADSITLDLVDYVF-VAMLLYI-------------------R 369

  Fly   290 DTMIQDNIVTDCHGF------VEAMFSLRLK 314
            |.:|..|..| |.|.      :..:.||.||
Zfish   370 DALIASNFQT-CLGLLMHYPPIGDIHSLLLK 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 60/313 (19%)
tbc1d5NP_001315187.1 TBC 71..373 CDD:214540 60/324 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.