DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and RN-tre

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_652381.1 Gene:RN-tre / 36554 FlyBaseID:FBgn0020620 Length:571 Species:Drosophila melanogaster


Alignment Length:335 Identity:81/335 - (24%)
Similarity:146/335 - (43%) Gaps:37/335 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DEYGFKRGDHFD--------YNNYSKFMDGYLKTLTRRRMKWEAILQQNTDLTQVDAKLKRYIRK 69
            |:|||.......        :.|         |....|..||..:|.|   ......||.:.:.|
  Fly    50 DKYGFLHDSRLPSTRDAQEVHRN---------KIEMERDKKWMKMLNQ---WPPPQDKLHKRVYK 102

  Fly    70 GIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLRTEPFDKEISDSISIDLPRTFPDNIHF----DM 130
            |||...|...|.|:.....:...:..::..:|:........:..|..|:.|.|.||:.|    .:
  Fly   103 GIPDRVRMVAWNKLLDIQQSINNNAGVYLRMLQLARKYSTETRQIDADVNRQFRDNLAFRERYSV 167

  Fly   131 KKQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVENIVPQYHSHNM--- 192
            |:..|:|:|.||:.:|.::|||||:..:||:||:...:|| :||.|..::.:  .:|..|.:   
  Fly   168 KQCSLFNVLNAYSIYNSELGYCQGMACVAGVLLLYLHEEE-AFWALNTLITD--QKYGMHGLFIE 229

  Fly   193 --ANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCVFAE 255
              ..|.|.:.....::.:.:..:::|.....:...:.|.|||..:|.|.:|....||:||....:
  Fly   230 GFPKLTRFIDHHDRIMSKIMRKLHKHFTKHNVDALLYAIKWFFVVFVERVPFSLSLRVWDIFMLD 294

  Fly   256 GYKIVFRAALTMFVTHKNAILGCDDIAALANLFRDTMIQDNIVTDCHGFVEAMFSLRLKRSELES 320
            |.:::...|:|:...||:.:|...|:.|:.. :....:..|........::|:..:..|..:|  
  Fly   295 GDRVILSMAITILYLHKDELLRLKDMDAIIE-YLQVRLHKNFGYSDDDAIQALERVMKKLKDL-- 356

  Fly   321 LRKVAVLNPA 330
              |:.|..||
  Fly   357 --KLDVPPPA 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 57/217 (26%)
RN-treNP_652381.1 TBC 100..315 CDD:214540 57/217 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456607
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.