DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and Tbc1d10b

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001102391.1 Gene:Tbc1d10b / 365372 RGDID:1309191 Length:795 Species:Rattus norvegicus


Alignment Length:337 Identity:103/337 - (30%)
Similarity:147/337 - (43%) Gaps:53/337 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDATASSKFSDV-----------------DEYGFKRGDHFDYNNYSKFMDGYL--KTLTRRRMKW 46
            |..|..|...||                 |:|||..|     :.||..::..:  ....:|.:||
  Rat   259 MSGTLESLTDDVSSVGSDSEINGLALRKTDKYGFLGG-----SQYSGSLESSIPVDVARQRELKW 318

  Fly    47 EAILQQNTD--LTQVDAKLKRYIRKGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLRTEPFDKE 109
            ..:. .|.|  |::...|:|...|||||...|...|..:|.:.....::|..|..|.|. |.|.:
  Rat   319 LEMF-SNWDKWLSRRFQKVKLRCRKGIPSSLRAKAWQYLSNSKELLEQNPGKFEELERA-PGDPK 381

  Fly   110 ISDSISIDLPRTFPDNIHFDMK----KQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEE 170
            ..|.|..||.|.||.:..|..:    :|.||.||.||..:..|.||||....:|.:||:.. ..|
  Rat   382 WLDVIEKDLHRQFPFHEMFAARGGHGQQDLYRILKAYTIYRPDEGYCQAQAPVAAVLLMHM-PAE 445

  Fly   171 KSFWLLKHIVENIVPQYHSHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICI 235
            ::||.|..|.:..:|.|:|..:..:..|..:|..|:.|..|..:||:....:...:..::||:||
  Rat   446 QAFWCLVQICDKYLPGYYSAGLEAIQLDGEIFFALLRRASPLAHRHLRRQRIDPVLYMTEWFMCI 510

  Fly   236 FAEVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTHKNAILGCDDIAALANLFRDTMIQDNIVTD 300
            ||..||..:|||:||..|.||.||:||.||.                    |.|.|:.....:..
  Rat   511 FARTLPWASVLRVWDMFFCEGVKIIFRVALV--------------------LLRHTLGSVEKLRS 555

  Fly   301 CHGFVEAMFSLR 312
            |.|..|.|..||
  Rat   556 CQGMYETMEQLR 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 74/212 (35%)
Tbc1d10bNP_001102391.1 TBC 340..545 CDD:214540 75/226 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.