DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and Sgsm3

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_942082.2 Gene:Sgsm3 / 362963 RGDID:735113 Length:763 Species:Rattus norvegicus


Alignment Length:301 Identity:84/301 - (27%)
Similarity:147/301 - (48%) Gaps:20/301 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DEYGFKRGDHFDYNNYSKFMDGYLKTLTRRRMKWEAILQ--QNTDLTQV-----------DAKLK 64
            ||:||:..........|:.....|.....:|::|:|.|:  .|.|:..:           ..||:
  Rat    57 DEFGFRVDKEGSEPGCSQMAGTPLVEDPPQRLRWQAHLEFTHNHDVGDLTWDKIAVSLPRSEKLR 121

  Fly    65 RYIRKGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLRTEPFDKEI-SDSISIDLPRTFPDNIHF 128
            ..:..|||...||.:||::|||...::.|...:|.:::....|:.| :..|..||.||.|.|..|
  Rat   122 SLVLAGIPHGMRPQLWMRLSGALQKKKNSELSYREIVKNSSNDETIAAKQIEKDLLRTMPSNACF 186

  Fly   129 ----DMKKQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVENIVP-QYH 188
                .:...||..:|.|.|....::|||||...:|..||:.. :||.:||::..|:|:::| .|.
  Rat   187 ANVNSIGVPRLRRVLRALAWLYPEIGYCQGTGMVAACLLLFL-EEEDAFWMMCAIIEDLLPASYF 250

  Fly   189 SHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCVF 253
            |..:..:..|..|.|.|:::.:|.:::.:....:...:|...||:..||.|:.:..:|||||..|
  Rat   251 STTLLGVQTDQRVLRHLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVHIRLLLRIWDLFF 315

  Fly   254 AEGYKIVFRAALTMFVTHKNAILGCDDIAALANLFRDTMIQ 294
            .||..::|:..|.|....:..::..::.|::.|...|...|
  Rat   316 YEGSLVLFQTTLGMLRLKEEELIQSENSASIFNTLSDIPAQ 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 66/214 (31%)
Sgsm3NP_942082.2 TBC 127..338 CDD:214540 66/211 (31%)
SH3_SGSM3 497..549 CDD:212747
RUN 576..727 CDD:397055
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162786at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.