DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and Grtp1

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001163948.1 Gene:Grtp1 / 361180 RGDID:1309210 Length:342 Species:Rattus norvegicus


Alignment Length:311 Identity:133/311 - (42%)
Similarity:198/311 - (63%) Gaps:8/311 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ASSKFSDVDEYGFKRGDHFDYNNYSKFMDGYLKTLTRRRMKWEAILQQNTDLTQVDAKLKRYIRK 69
            |.::...:|.|||:|.:.|||..|.:|...||..||:|.:||..:|:.:..:.: ...:|||:||
  Rat    10 ARARVPRIDPYGFERPEDFDYAAYEEFFSTYLVILTKRAIKWSKLLKGSGGVRK-SVTVKRYVRK 73

  Fly    70 GIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLRTEPFDKEISDSISIDLPRTFPDNIHF-----D 129
            |||..:|..|||.:|||.|...::|..:..||..|. ...:.::|..||.||||||:.|     .
  Rat    74 GIPLEHRARVWMAVSGAQAQMDQNPGYYHRLLEGES-SSRLEEAIRTDLNRTFPDNVMFRKTADP 137

  Fly   130 MKKQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVENIVPQYHSHNMAN 194
            ..::.|||:|:||..||:|||||||:|:|||.|:::|.:||:|||||..:|..|:|.|:|..|..
  Rat   138 CLQKTLYNVLLAYGLHNQDVGYCQGMNFIAGYLILITKNEEESFWLLDALVGRILPDYYSPAMLG 202

  Fly   195 LLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCVFAEGYKI 259
            |..|..|..|||..::|||...:|..|:.:.::.|:||||:|.::||||||||||||:|.||.||
  Rat   203 LKTDQEVLAELVRMKLPAVAALMDGHGVLWTLLVSRWFICLFVDILPVETVLRIWDCLFNEGSKI 267

  Fly   260 VFRAALTMFVTHKNAILGCDDIAALANLFRDTMIQDNIVTDCHGFVEAMFS 310
            :||.|||:...|:..||....:..:.:.|:. :.:.:.||:||.|::.:||
  Rat   268 IFRVALTLIKQHQEFILEASSVPDICDKFKQ-ITKGDFVTECHTFMQKIFS 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 101/213 (47%)
Grtp1NP_001163948.1 TBC 71..284 CDD:214540 101/213 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 177 1.000 Domainoid score I3507
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H84592
Inparanoid 1 1.050 207 1.000 Inparanoid score I3637
OMA 1 1.010 - - QHG53652
OrthoDB 1 1.010 - - D1162786at2759
OrthoFinder 1 1.000 - - FOG0003486
OrthoInspector 1 1.000 - - oto97045
orthoMCL 1 0.900 - - OOG6_100958
Panther 1 1.100 - - LDO PTHR22957
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2377
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.980

Return to query results.
Submit another query.