DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and Tbc1d10a

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001015022.1 Gene:Tbc1d10a / 360968 RGDID:1311641 Length:505 Species:Rattus norvegicus


Alignment Length:326 Identity:97/326 - (29%)
Similarity:152/326 - (46%) Gaps:39/326 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ATA---SSKFSDVDEYGF--KRGDHFDYNNYSKFMDGY-----LKTLTRRRMKWEAILQQNTD-- 55
            |||   ||..||.:..||  :|.|.|.:...|:..:|.     |:.|.:|..||..:| .|.|  
  Rat    33 ATADELSSLGSDSEANGFAERRIDKFGFIVGSQGAEGALEEVPLEVLRQRESKWLDML-NNWDKW 96

  Fly    56 LTQVDAKLKRYIRKGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLRTEPFDKEISDSISIDLPR 120
            :.:...|::...:||||...|...|..:||.....:::|..| :.|...|.|.:..|.|..||.|
  Rat    97 MAKKHKKIRLRCQKGIPPSLRGRAWQYLSGGKVKLQQNPGKF-DELDMSPGDPKWLDVIERDLHR 160

  Fly   121 TFPDNIHFDMK----KQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVE 181
            .||.:..|..:    :|.|:.:|.||..:..:.||||....||.:||:.. ..|::||.|..:.|
  Rat   161 QFPFHEMFVSRGGHGQQDLFRVLKAYTLYRPEEGYCQAQAPIAAVLLMHM-PAEQAFWCLVQVCE 224

  Fly   182 NIVPQYHSHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVL 246
            ..:|.|:|..:..:..|..:...|:.:..|..::|:....:...:..::||:|.||..||..:||
  Rat   225 KYLPGYYSEKLEAIQLDGEILFSLLQKVSPVAHKHLSRQKIDPLLYMTEWFMCAFARTLPWSSVL 289

  Fly   247 RIWDCVFAEGYKIVFRAALTMFVTHKNAILGCDDIAALANLFRDTMIQDNIVTDCHGFVEAMFSL 311
            |:||..|.||.||:||..|.:.   |:|:...:.:.|                 |.|..|.:..|
  Rat   290 RVWDMFFCEGVKIIFRVGLVLL---KHALGSPEKLRA-----------------CQGQYETIEQL 334

  Fly   312 R 312
            |
  Rat   335 R 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 68/212 (32%)
Tbc1d10aNP_001015022.1 TBC 110..313 CDD:214540 66/207 (32%)
VCX_VCY 404..>501 CDD:291884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.