DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and Tbc1d14

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001106836.1 Gene:Tbc1d14 / 360956 RGDID:1309993 Length:714 Species:Rattus norvegicus


Alignment Length:314 Identity:75/314 - (23%)
Similarity:121/314 - (38%) Gaps:73/314 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LKTLTRRRMKWE-----------AILQQNTDLTQ------VDAKLKRYIRKGIPGPYRPDVWMKI 83
            ||...||:.:.|           |:|..|.::..      ...|::....:|||...|..||...
  Rat   371 LKEAQRRKKQLEERCKVEESIGNAVLTWNNEILPNWETMWCSKKVRDLWWQGIPPSVRGKVWSLA 435

  Fly    84 SG--------------AAAAQR-RSPDLFRNLLRTE-----PFDKEIS-DSISIDLPRTFPDNIH 127
            .|              |.|.:| ||.....:.:..|     ..|:|.| :.|.:|:.||||:...
  Rat   436 IGNELNITHELFDICLARAKERWRSLSTGGSEVENEDAGFSAADREASLELIKLDISRTFPNLCI 500

  Fly   128 F-------DMKKQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVENIVP 185
            |       ||    |::||.||..:..||||.||:::||.:|::..|..: :|....:::.....
  Rat   501 FQQGGPYHDM----LHSILGAYTCYRPDVGYVQGMSFIAAVLILNLDTAD-AFIAFSNLLNKPCQ 560

  Fly   186 QYH---SHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLR 247
            ...   .|.:  :|...|.|.......:|.:..|.....|...:....|...::::.||::...|
  Rat   561 MAFFRVDHGL--MLTYFAAFEVFFEENLPKLFAHFKKNNLTADIYLIDWIFTLYSKSLPLDLACR 623

  Fly   248 IWDCVFAEGYKIVFRAAL------------------TMFVTHKNAILGCDDIAA 283
            |||....:|.:.:||.||                  ..|:|.....|..||:.|
  Rat   624 IWDVFCRDGEEFLFRTALGILKLFEDILTRMDFIHSAQFLTRLPEDLPADDVFA 677

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 62/257 (24%)
Tbc1d14NP_001106836.1 DUF4207 147..384 CDD:290615 5/12 (42%)
TBC 419..651 CDD:214540 60/238 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.