DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and Tbc1d9b

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001381172.1 Gene:Tbc1d9b / 360520 RGDID:1310147 Length:1263 Species:Rattus norvegicus


Alignment Length:250 Identity:77/250 - (30%)
Similarity:127/250 - (50%) Gaps:25/250 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 AKLKRYIRKGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLRTEPFDKEI------SDSISIDLP 119
            ||.:..:.||||...|.::|:..|||.......|..:..|:     :|.:      ::.|..||.
  Rat   500 AKTRELVLKGIPESLRGELWLLFSGAWNEMVTHPGYYAELV-----EKSMGKYSLATEEIERDLH 559

  Fly   120 RTFPDNIHF--DMKKQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVEN 182
            |:.|::..|  ::....|..:|.|||..|..:||||.:|.:..:||:. ..||::||||..:.|.
  Rat   560 RSMPEHPAFQNELGIAALRRVLTAYAFRNPTIGYCQAMNIVTSVLLLY-GSEEEAFWLLVALCER 623

  Fly   183 IVPQYHSHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIAS---KWFICIFAEVLPVET 244
            ::|.|::..:...|.|..:|.||....:|.::..:..||    ||:|   .||:.:|..|:|.|:
  Rat   624 MLPDYYNTRVVGALVDQGIFEELTRDVLPRLSEKMQELG----VISSISLSWFLTLFLSVMPFES 684

  Fly   245 VLRIWDCVFAEGYKIVFRAALTMFVTHKNAILGC-DDIAALANLFRDTMIQDNIV 298
            .:.|.||.|.||.|::.:.||.:...:...:|.| |:..|:..|.|   ..||:|
  Rat   685 AVVIVDCFFYEGIKVILQVALAVLDANMEQLLDCSDEGEAMTVLGR---YLDNVV 736

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 66/219 (30%)
Tbc1d9bNP_001381172.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.