DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and TBC1D26

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001375394.1 Gene:TBC1D26 / 353149 HGNCID:28745 Length:468 Species:Homo sapiens


Alignment Length:283 Identity:66/283 - (23%)
Similarity:117/283 - (41%) Gaps:54/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 TRRRMKWEAILQQNTDLTQVDA--KLKRYIRKGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLR 102
            ::|..||:.:|   .|.|:..:  ||.:.:.|.||...|...|..:......:.::|..::.:..
Human    72 SKRTNKWQKML---ADWTKYRSTKKLSQRVYKVIPLAVRGRAWSLLLDIDRIKSQNPGKYKVMKE 133

  Fly   103 TEPFDKEISDSISIDLPRTFPDNI----HFDMKKQRLYNILIAYAHHNRDVGYCQGLNYIAGLLL 163
            .......|...|.:|:..|...::    .|.:|:|.|.:||:||:.:|.:|||.:.|:.|..:||
Human   134 KGKRSSRIIHCIQLDVSHTLQKHMMFIQRFGVKQQELCDILVAYSAYNPEVGYHRDLSRITAILL 198

  Fly   164 IVTDDEEKSFWLLKHIVENIVPQYHSHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIA 228
            :.. .||.:||.|    ..::..::|.|.|.|.|.|:...:::.:..|.:.||:...||      
Human   199 LCL-PEEDAFWAL----TQLLAVFYSPNTAWLERLLSHQEQVLHKSFPKIMRHLGKEGL------ 252

  Fly   229 SKWFICI-----------FAEVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTHKNAIL------ 276
                 ||           |.:.......||:||....||.:::.......|..|:..::      
Human   253 -----CIEGSMLTRLLRCFLDGKSFGLTLRLWDVFILEGARVLTAMVHASFKIHRKHLMKLSWST 312

  Fly   277 ------------GCDDIAALANL 287
                        ..:|.|.|.||
Human   313 VWEFQERLSQSWALEDNAVLRNL 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 53/223 (24%)
TBC1D26NP_001375394.1 TBC 98..306 CDD:214540 53/223 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.