DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and Tbc1d15-17

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001259806.1 Gene:Tbc1d15-17 / 33184 FlyBaseID:FBgn0031233 Length:715 Species:Drosophila melanogaster


Alignment Length:275 Identity:55/275 - (20%)
Similarity:104/275 - (37%) Gaps:64/275 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 AKLKRYI-RKGIPGPYRPDVW-----------MKISGAAAAQRRSPDLFR------NLLRTEPFD 107
            |::|..| |.|:....||:||           ..:......:::|.:.:.      .:..|:..:
  Fly   362 ARIKELIFRGGVVQSLRPEVWKFLLNYYLWSDTHVERIERRKQKSIEYYNMKAQWLAMTTTQEAN 426

  Fly   108 ----KEISDSISIDLPRT--------FPDNIHFDMKKQRLYNILIAYAHHNRDVGYCQGLNYIAG 160
                :|....|..|:.||        ..||.:..:    |..||:.|..:|.|:||.||::.:..
  Fly   427 FCGYRERKCQIEKDVKRTDRSLQFFAGEDNPNLTL----LQGILMTYVMYNFDLGYVQGMSDLLA 487

  Fly   161 LLLIVTDDEEKSFWLLKHIVENIVPQYHSHNMANLLRDLAVFRELV-IRRIPAVN----RHVDNL 220
            .:|.:..:|..:||.....:|.:...: ..:.|.:....|..|.|: ....|..|    ...||:
  Fly   488 PILEIQVNEVDTFWCFVGFMELVFTNF-DIDQAGMKTQFAQIRRLIEFANAPLFNYMRSHDSDNM 551

  Fly   221 GLPYPVIASKWFICIFAEVLPVETVLRIWDCVFAE----GYKIVFRAAL---------------T 266
                 ....:|.:..:...|..|.||::|:|::..    .:.::|..|:               |
  Fly   552 -----YFCFRWLLVWYKRELNSEDVLKLWECLWTRLPCPNFHLLFSVAILDQETRVIIDSQYEFT 611

  Fly   267 MFVTHKNAILGCDDI 281
            ..:.|.|.:.|..|:
  Fly   612 EILKHVNELSGNIDV 626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 51/262 (19%)
Tbc1d15-17NP_001259806.1 DUF3548 37..>191 CDD:192931
TBC 369..598 CDD:214540 47/238 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456565
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.