DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and GstT3

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster


Alignment Length:156 Identity:28/156 - (17%)
Similarity:50/156 - (32%) Gaps:70/156 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 LNYIAGLLLIVTDDEEKSFWLLKHIVENIVPQYHSHNMANLLRDLAVFRELVIRRIPAVNRHVDN 219
            ::::|.||.:..|:::..                           ..|.|::.||:|  :|...|
  Fly     3 VSFLASLLGLSNDEDQLQ---------------------------VAFDEVLKRRVP--SRQPTN 38

  Fly   220 LGLPYPV-----IASK----WFICIFAEVLPVETVLRIWDCVFA--------------------- 254
            |.:..|:     :.|:    .||......:|.|      |||.|                     
  Fly    39 LRMSAPIRYYYDLMSQPSRALFIIFRLSNMPFE------DCVVALRNGEHLTEDFKKEINRFQRV 97

  Fly   255 -----EGYKIVFRAALTMFVTHKNAI 275
                 .|||:....|:..:::.|..|
  Fly    98 PCIHDNGYKLAESVAILRYLSAKGKI 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 28/156 (18%)
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 13/81 (16%)
GstA 47..243 CDD:223698 15/83 (18%)
GST_C_Theta 135..259 CDD:198292
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.