DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and Tbc1d2

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_006238118.1 Gene:Tbc1d2 / 313234 RGDID:1306860 Length:924 Species:Rattus norvegicus


Alignment Length:358 Identity:109/358 - (30%)
Similarity:175/358 - (48%) Gaps:40/358 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DATASSKFSDVDEYGFKRGDHFDYNNYSKFMDGYLKTLTR---------RRMKWEAILQQNTD-- 55
            |:...|..|:.|:|||.....::..:        ||.|.:         ..:..||:.:...|  
  Rat   546 DSVGLSPVSEYDDYGFLTVPDYEVED--------LKLLAKIQALEVRSHHLLALEAVERPLRDRW 602

  Fly    56 --LTQV--DAKLKRYIRKGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLL-RTEPFDKEISDSIS 115
              ||::  .|:||:.:|.|:|..:||.||..:.........|...::.|| |....:...:..|.
  Rat   603 ATLTELMPSAELKQLLRAGVPREHRPRVWRWLVHRRVQHLHSSGCYQELLARGRACEHPAARQIE 667

  Fly   116 IDLPRTFPDNIHFDMK----KQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLL 176
            :||.||||.|.||...    ..:|..:|:|::..|..:|||||||.:|.:.|:|.:|||.:||.|
  Rat   668 LDLNRTFPTNKHFTCPTSSFPDKLRRVLLAFSWQNPTIGYCQGLNRLAAIALLVLEDEESAFWCL 732

  Fly   177 KHIVENIVP-QYHSHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVL 240
            ..|||.|:| :|:|..:.....|..|.::|:..::|.:..|:....:...:|...||:.|||:.|
  Rat   733 VAIVETILPAEYYSKTLTASQVDQRVLQDLLSEKLPRLTAHLGQRHVDLSLITFNWFLVIFADSL 797

  Fly   241 PVETVLRIWDCVFAEGYKIVFRAALTMFVTHKNAILGCDD---IAALANLFRDTMIQDNIVT--- 299
            ..:.:||:||....||.|:|||.||.:|..::.|||...|   |......|..|:.....:|   
  Rat   798 ISDILLRVWDAFLYEGTKVVFRYALAIFKYNEEAILRLQDSLEIYQYLRFFTKTICDSRKLTSIA 862

  Fly   300 --DCHGF-VEAMFSLR-LKRSELES-LRKVAVL 327
              |.:.| ::.:..|| ..|..||: ||::.:|
  Rat   863 FNDMNPFPMKQLRQLRAAHRERLEAELRELELL 895

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 74/214 (35%)
Tbc1d2XP_006238118.1 PH_TBC1D2A 44..145 CDD:269966
PH 44..137 CDD:278594
TBC 621..833 CDD:214540 73/211 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162786at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100958
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.