DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and Rabgap1

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001101311.1 Gene:Rabgap1 / 311911 RGDID:1304691 Length:1065 Species:Rattus norvegicus


Alignment Length:288 Identity:74/288 - (25%)
Similarity:129/288 - (44%) Gaps:34/288 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DHFDYNNYSKFMDGY-----------LKTLTRRRMKWEAILQQNTDLTQVDAKLKRYIRKGIPGP 74
            |..:.:|....:.|:           |:|......||      :.:|.....:|...:|.|:|..
  Rat   508 DDEEEDNDEPLLSGFGDVSKECAEKILETWGELLSKW------HLNLNVRPKQLSSLVRSGVPEA 566

  Fly    75 YRPDVWMKISGAAAAQRRSPDL---FRNLLRTE-PFDKEISDSISIDLPRTFPDNIHFDMK---- 131
            .|.:||..::|.    ..:..|   :|.|:..| |.|    .:|:.|:.||||.:.:|...    
  Rat   567 LRGEVWQLLAGC----HNNDHLVEKYRILITKESPQD----SAITRDINRTFPAHDYFKDTGGDG 623

  Fly   132 KQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVENIVPQYHSHNMANLL 196
            :..||.|..||:.::.::|||||.:::|.:||:...:|:....|:|.:.:..:.:....|..:|.
  Rat   624 QDSLYKICKAYSVYDEEIGYCQGQSFLAAVLLLHMPEEQAFSVLVKIMFDYGLRELFKQNFEDLH 688

  Fly   197 RDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCVFAEGYKIVF 261
            ........|:...||.:..|..::.|...:.||:||:.:|....|:..|..|.|.:..||..::|
  Rat   689 CKFYQLERLMQEYIPDLYNHFLDISLEAHMYASQWFLTLFTAKFPLYMVFHIIDLLLCEGISVIF 753

  Fly   262 RAALTMFVTHKNAILGCDDIAALANLFR 289
            ..||.:..|.|:.:|..|...|| ..||
  Rat   754 NVALGLLKTSKDDLLLTDFEGAL-KFFR 780

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 59/216 (27%)
Rabgap1NP_001101311.1 PTB_Rab6GAP 141..269 CDD:269922
DUF3694 303..433 CDD:403614
TBC 559..768 CDD:214540 59/216 (27%)
ERM 790..1016 CDD:395622
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.