DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and Tbc1d16

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_006248000.1 Gene:Tbc1d16 / 303734 RGDID:1588560 Length:766 Species:Rattus norvegicus


Alignment Length:291 Identity:66/291 - (22%)
Similarity:118/291 - (40%) Gaps:52/291 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RRMKWEAILQQNTDLTQVDAKLKRYIRK-----GIPGPYRPDVWMKI----SGAAAAQRRSPDLF 97
            ||:...|.|....||.||:.:.|  :|:     ||....|.:||..:    |..:.::.|  :..
  Rat   393 RRLDVSAWLNHLNDLGQVEEEYK--LRQAIFFGGIDVSIRGEVWPFLLHYYSHESTSEER--EAL 453

  Fly    98 RNLLRTE-----------------PFDKEISDSISIDLPRTFPDNIHF----DMKKQRLYNILIA 141
            |:..|.|                 .|.:.:..::..|:.||..:|..|    :...:.:..||:.
  Rat   454 RSQKRKEYAAIQQKRLSMPPEEHRAFWRNVQFTVDKDVVRTDRNNQFFRGEDNPNVESMRRILLN 518

  Fly   142 YAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVENIVPQYHSHNMANLLRDLAVFRELV 206
            ||.:|..:||.||::.:...:|....||..:||....:::|.: ...|....::.|.|...|||:
  Rat   519 YAVYNPAIGYSQGMSDLVAPILAEVLDESDTFWCFVGLMQNTI-FVSSPRDEDMERQLLYLRELL 582

  Fly   207 IRRIPAVNRHVDNLGLP--YPVIASKWFICIFAEVLPVETVLRIWDCVFAEGYKIVFRAALTMFV 269
            ........:|:.:||..  ..:...:|.:..|....|....||||:..:|......|.    :|:
  Rat   583 RLTHQRFYQHLVSLGEDGLQMLFCHRWLLLCFKREFPEGEALRIWEACWAHYQTDYFH----LFI 643

  Fly   270 THKNAILGCDDIAALANLFRDTMIQDNIVTD 300
                    |   .|:..::.|.:|:..:.||
  Rat   644 --------C---VAIVAIYGDDVIEQQLATD 663

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 51/240 (21%)
Tbc1d16XP_006248000.1 TBC 423..651 CDD:214540 52/245 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.