DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and Sgsm2

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_006246802.1 Gene:Sgsm2 / 303304 RGDID:1306957 Length:1050 Species:Rattus norvegicus


Alignment Length:273 Identity:59/273 - (21%)
Similarity:120/273 - (43%) Gaps:53/273 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GPYRPDVWMKISGAAAAQRRSPDLFRNLLRTEPFDKEISDSISIDLPRTFPDNIHFDM------- 130
            ||:.|| ..|::.|:..: ...:|......|  :..|:.|:::::|.|...|....|.       
  Rat   797 GPHDPD-QEKLAPASELE-GGEELTAVCAAT--YTIELLDTVALNLHRIDKDVQRCDRNYWYFTT 857

  Fly   131 -KKQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVENIVPQY------- 187
             ..:||.:|:.:|...:.|:||.||:..:...||::.|:::.::....|:::.:...:       
  Rat   858 PNLERLRDIMCSYVWEHLDMGYVQGMCDLLAPLLVILDNDQLAYSCFSHLMKRMSQNFPNGGAMD 922

  Fly   188 -HSHNMANLLR--DLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIW 249
             |..||.:|::  |..:| ||:         | .|....:.....:||:..|...|..|.|..:|
  Rat   923 THFANMRSLIQILDSELF-ELM---------H-QNGDYTHFYFCYRWFLLDFKRELLYEEVFAVW 976

  Fly   250 DCVFAEGYKIVFRAALTMFVTHKNAILGCDDIAALANLFRDTMIQDNIV--TDCHGFVEAMFSLR 312
            :.::|..:  :......:|:.           .||...:|: :|:||.:  ||...|    |:.|
  Rat   977 EVIWAARH--ISSEHFVLFIA-----------LALVEAYRE-IIRDNNMDFTDIIKF----FNER 1023

  Fly   313 LKRSELESLRKVA 325
            .:|.:.:.:.::|
  Rat  1024 AERHDAQEILRIA 1036

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 46/220 (21%)
Sgsm2XP_006246802.1 RUN 42..189 CDD:280855
PH_RUTBC 256..424 CDD:275431
TBC <838..1006 CDD:214540 39/192 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.