DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and Tbc1d17

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001099728.1 Gene:Tbc1d17 / 292886 RGDID:1309686 Length:646 Species:Rattus norvegicus


Alignment Length:275 Identity:59/275 - (21%)
Similarity:118/275 - (42%) Gaps:64/275 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KFMDGYLKTLTRRRMKWEAILQQNTDLTQVDAKLKRYIRKGIPGPYRPDV-WMKISGAAAAQRRS 93
            ||:.|||        .||:..:::          |.::||.....:|..: |..:|  |..:||:
  Rat   322 KFLLGYL--------SWESSAEEH----------KAHVRKKTDEYFRMKLQWKSVS--AEQERRN 366

  Fly    94 PDL--FRNLLRTEPFDKEISDSISIDLPRTF---PDNIHFDMKKQRLYNILIAYAHHNRDVGYCQ 153
            ..|  :|:|:     ::::|.:   |....|   |:|....:    |.:||:.|..::.|:||.|
  Rat   367 SLLHGYRSLI-----ERDVSRT---DRTNKFYEGPENPGLGL----LNDILLTYCMYHFDLGYVQ 419

  Fly   154 GLNYIAGLLLIVTDDEEKSFWLLKHIVENIVPQYHSHNMANLLRDLAVFRELVIRRI---PAVNR 215
            |::.:...:|.|..:|..:||.....:| :|......:...:.|.|.  :.|::.|:   |..: 
  Rat   420 GMSDLLSPILFVVQNEVDAFWCFCGFME-LVHGNFEESQETMKRQLG--QLLLLLRVLDQPLCD- 480

  Fly   216 HVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCVFA--EGYKIVFRAALTMFVTHKNAILGC 278
            .:|:..........:|.:..|....|...|||:|:.::.  .|..:             :.::.|
  Rat   481 FLDSQDSGSLCFCFRWLLIWFKREFPFPDVLRLWEVLWTGLPGPNL-------------HLLVAC 532

  Fly   279 DDIAALANLFRDTMI 293
                |:.::.|||::
  Rat   533 ----AILDMERDTLM 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 46/219 (21%)
Tbc1d17NP_001099728.1 DUF3548 3..218 CDD:192931
TBC 308..543 CDD:214540 59/273 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.