DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and Usp6nl

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_006254294.1 Gene:Usp6nl / 291309 RGDID:1311786 Length:833 Species:Rattus norvegicus


Alignment Length:325 Identity:89/325 - (27%)
Similarity:148/325 - (45%) Gaps:33/325 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DEYGFKRGDHFDYNNYSKFMDGYLKTLTRRRMKWEAILQ-----QNTDLTQVDAKLKRYIRKGIP 72
            |.:||...:...|.|.:  .|...:....|..||..:|:     :||:      |..|.|.||||
  Rat    63 DRFGFLHEEELPYPNAA--ADRQKQLEIERTSKWLKMLKRWERYKNTE------KFHRRIYKGIP 119

  Fly    73 GPYRPDVWMKISGAAAAQRRSPDLFRNLL-RTEPFDKEISDSISIDLPRTFPDNIHF----DMKK 132
            ...|.:||..:......:..:.||:..|. |......:|. .|.:|:.|||.|:|.|    .:|:
  Rat   120 LQLRGEVWALLLEIPKMKEETRDLYSKLKHRARGCSPDIR-QIDLDVNRTFRDHIMFRDRYGVKQ 183

  Fly   133 QRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLL-------KHIVENIVPQYHSH 190
            |.|:::|.||:.:|.:||||||::.|..|||:.. :||.:||.|       ||.:.....|    
  Rat   184 QSLFHVLAAYSIYNTEVGYCQGMSQITALLLMYM-NEEDAFWALVKLFSGPKHAMHGFFVQ---- 243

  Fly   191 NMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCVFAE 255
            ....|||......:::.:.:..:.:|:|:..:.......|||...|.:..|....|||||....|
  Rat   244 GFPKLLRFQEHHEKILNKFLSKLKQHLDSQEIYTSFYTMKWFFQCFLDRTPFRLNLRIWDIYIFE 308

  Fly   256 GYKIVFRAALTMFVTHKNAILGCDDIAALANLFRDTMIQDNIVTDCHGFVEAMFSL-RLKRSELE 319
            |.:|:...:.|:...|:..::.. .:..|....::|:.:|....|.....:...|: .|||::|:
  Rat   309 GERILTAMSYTILKLHRKHLMKL-SMEELVEFLQETLAKDFFFEDDFVIEQLQVSMTELKRAKLD 372

  Fly   320  319
              Rat   373  372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 66/220 (30%)
Usp6nlXP_006254294.1 TBC 114..329 CDD:214540 66/220 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.