DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and Sgsm1

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_017453793.1 Gene:Sgsm1 / 288743 RGDID:1308178 Length:1096 Species:Rattus norvegicus


Alignment Length:253 Identity:59/253 - (23%)
Similarity:108/253 - (42%) Gaps:63/253 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 FDKEISDSISIDLPRTFPDNIHFDMKK-------------QRLYNILIAYAHHNRDVGYCQGLNY 157
            :..|:.|..:::|.|     |..|:::             ::|.||:.:|...:.::||.||:..
  Rat   872 YSPELLDLYTVNLHR-----IEKDVQRCDRSYWYFTAANLEKLRNIMCSYIWQHIEIGYVQGMCD 931

  Fly   158 IAGLLLIVTDDEEKSF----WLLKHIVENI----VPQYHSHNMANLLR--DLAVFRELVIRRIPA 212
            :...||::.|||..:|    .|:|.:.:|.    ....|..||.:|::  |..:| ||:      
  Rat   932 LLAPLLVILDDEALAFSCFTELMKRMNQNFPHGGAMDTHFANMRSLIQILDSELF-ELM------ 989

  Fly   213 VNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTHKNAILG 277
               | .|....:.....:||:..|...|..:.|..:|:.::|.  |.|..|...:|:.       
  Rat   990 ---H-QNGDYTHFYFCYRWFLLDFKRELVYDDVFSVWETIWAA--KHVSSAHYVLFIA------- 1041

  Fly   278 CDDIAALANLFRDTMIQDNI-VTDCHGFVEAMFS-------LRLKRSELESLRKVAVL 327
                .||..::||.::::|: .||...|...|..       |:|.|   :.:.||.:|
  Rat  1042 ----LALVEVYRDIILENNMDFTDIIKFFNEMAERHNAKQILQLAR---DLVHKVQIL 1092

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 44/192 (23%)
Sgsm1XP_017453793.1 RUN 44..186 CDD:397055
PH_RUTBC 257..428 CDD:275431
TBC <884..1053 CDD:214540 46/197 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.