DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and RABGAP1

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_036329.3 Gene:RABGAP1 / 23637 HGNCID:17155 Length:1069 Species:Homo sapiens


Alignment Length:294 Identity:76/294 - (25%)
Similarity:136/294 - (46%) Gaps:43/294 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 WEAILQQ-NTDLTQVDAKLKRYIRKGIPGPYRPDVWMKISGAAAAQRRSPDL---FRNLLRTE-P 105
            |..:|.: :.:|.....:|...:|.|:|...|.:||..::|.    ..:..|   :|.|:..| |
Human   541 WGELLSKWHLNLNVRPKQLSSLVRNGVPEALRGEVWQLLAGC----HNNDHLVEKYRILITKESP 601

  Fly   106 FDKEISDSISIDLPRTFPDNIHFDMK----KQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVT 166
            .|    .:|:.|:.||||.:.:|...    :..||.|..||:.::.::|||||.:::|.:||:..
Human   602 QD----SAITRDINRTFPAHDYFKDTGGDGQDSLYKICKAYSVYDEEIGYCQGQSFLAAVLLLHM 662

  Fly   167 DDEEKSFWLLKHIVENIVPQYHSHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKW 231
            .:|:....|:|.:.:..:.:....|..:|.........|:...||.:..|..::.|...:.||:|
Human   663 PEEQAFSVLVKIMFDYGLRELFKQNFEDLHCKFYQLERLMQEYIPDLYNHFLDISLEAHMYASQW 727

  Fly   232 FICIFAEVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTHKNAILGCDDIAALANLFRDTMIQDN 296
            |:.:|....|:..|..|.|.:..||..::|..||.:..|.|      ||:               
Human   728 FLTLFTAKFPLYMVFHIIDLLLCEGISVIFNVALGLLKTSK------DDL--------------- 771

  Fly   297 IVTDCHGFVEAMFSLRLK---RSELESLRKVAVL 327
            ::||..|.:: .|.::|.   ||| |:.:|:..|
Human   772 LLTDFEGALK-FFRVQLPKRYRSE-ENAKKLMEL 803

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 59/216 (27%)
RABGAP1NP_036329.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..79
PTB_Rab6GAP 145..273 CDD:269922
DUF3694 307..437 CDD:403614
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 482..527
TBC 563..772 CDD:214540 61/237 (26%)
Smc <823..>1047 CDD:224117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.