DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and TBC1D30

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_024304669.1 Gene:TBC1D30 / 23329 HGNCID:29164 Length:944 Species:Homo sapiens


Alignment Length:314 Identity:86/314 - (27%)
Similarity:148/314 - (47%) Gaps:54/314 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 AILQQNTDLTQVDAKLK----------------------RYIRKGIPGPYRPDVWMKISG----A 86
            |.||..:...:||.|||                      ..:..|||..:|..||:.::.    :
Human   205 ACLQAVSQKRRVDTKLKFTLEPSLGQNGFQQWYDALKAVARLSTGIPKEWRRKVWLTLADHYLHS 269

  Fly    87 AAAQRRSPDLFRNLLRTEPFDKEISDSISIDLPRTFPDNI---HFDMKKQRLYNILIAYAHHNRD 148
            .|........|....|:.|.|..:...|..||.||...:.   ..:..:..|..:|:|||..|:.
Human   270 IAIDWDKTMRFTFNERSNPDDDSMGIQIVKDLHRTGCSSYCGQEAEQDRVVLKRVLLAYARWNKT 334

  Fly   149 VGYCQGLNYIAGLLL-IVTDDEEKSFWLLKHIVENIVPQ-YHSHNMANLLRDLAVFRELVIRRIP 211
            ||||||.|.:|.|:| ::..:|..:..::.::::.::|: |..:|:..|..|:||||:|:..::|
Human   335 VGYCQGFNILAALILEVMEGNEGDALKIMIYLIDKVLPESYFVNNLRALSVDMAVFRDLLRMKLP 399

  Fly   212 AVNRHVDNL----------GLPYP---VIASKWFICIFAEVLPVETVLRIWDCVFAEGYKIVFRA 263
            .:::|:|.|          |...|   |...:||:.:||..||.:|||:|||.||.||.:|:.|.
Human   400 ELSQHLDTLQRTANKESGGGYEPPLTNVFTMQWFLTLFATCLPNQTVLKIWDSVFFEGSEIILRV 464

  Fly   264 ALTMFVTHKNAILGCDDIAALANLFRDTM------IQDNIVTDCHGFVEAMFSL 311
            :|.::......|..|:    .|:.|..||      :.:|.:...|..::.::|:
Human   465 SLAIWAKLGEQIECCE----TADEFYSTMGRLTQEMLENDLLQSHELMQTVYSM 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 69/230 (30%)
TBC1D30XP_024304669.1 RabGAP-TBC 296..476 CDD:306939 58/179 (32%)
DUF4682 637..785 CDD:318030
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162786at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.