DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and TBC1D12

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_056003.1 Gene:TBC1D12 / 23232 HGNCID:29082 Length:775 Species:Homo sapiens


Alignment Length:313 Identity:69/313 - (22%)
Similarity:132/313 - (42%) Gaps:54/313 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KTLTRRRMK-----------WEAILQQNTDLTQVDAKLKRYIRKGIPGPYRPDVWMKISGAAAAQ 90
            |.:.:.|.|           |...:..|.::.:...:::....:|:|...|..||....|...  
Human   440 KRIMKERFKQEENIASAMVIWINEILPNWEVMRSTRRVRELWWQGLPPSVRGKVWSLAVGNEL-- 502

  Fly    91 RRSPDLFRNLL-----RTEPF---------------DKEIS-DSISIDLPRTFPDNIHFDMK--- 131
            ..:|:|:...|     |.:.|               |:|.| :.|.:|:.|||| :::...|   
Human   503 NITPELYEIFLSRAKERWKSFSETSSENDTEGVSVADREASLELIKLDISRTFP-SLYIFQKGGP 566

  Fly   132 -KQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVE---NIVPQYHSHNM 192
             ...|::||.||..:..||||.||:::||. :||:..:|..:|....:::.   .:......|:|
Human   567 YHDVLHSILGAYTCYRPDVGYVQGMSFIAA-VLILNLEEADAFIAFANLLNKPCQLAFFRVDHSM 630

  Fly   193 ANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCVFAEGY 257
              :|:..|.|.......:..:..|..:..|...:....|...::::.||::...|:||....:|.
Human   631 --MLKYFATFEVFFEENLSKLFLHFKSYSLTPDIYLIDWIFTLYSKSLPLDLACRVWDVFCRDGE 693

  Fly   258 KIVFRAALTMFVTHKNAILGCDDIAALANLFRDTMIQDNIVTDCHGFVEAMFS 310
            :.:||..|.:...:::.:|..|.|.....|   |.:.::|.:      |.:||
Human   694 EFLFRTGLGILRLYEDILLQMDFIHIAQFL---TKLPEDITS------EKLFS 737

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 55/236 (23%)
TBC1D12NP_056003.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..66
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..312
TBC 481..712 CDD:214540 55/236 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.