DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and TBC1D2B

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001374071.1 Gene:TBC1D2B / 23102 HGNCID:29183 Length:974 Species:Homo sapiens


Alignment Length:359 Identity:99/359 - (27%)
Similarity:165/359 - (45%) Gaps:55/359 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SDVDEYGFKR--GDHFDYNNYSKFMDGYLKT--LTRRR-----MKWEAILQQNTDLTQV-DAKLK 64
            |:.|.|||:.  .|..:....:|.....|||  ||..:     :|||.......:...: ..:||
Human   592 SEYDIYGFRTVPEDDEEEKLVAKVRALDLKTLYLTENQEVSTGVKWENYFASTVNREMMCSPELK 656

  Fly    65 RYIRKGIPGPYRPDVW--------MKISGAAAAQRRSPDLFRNLLRTEPFDKE--ISDSISIDLP 119
            ..||.|||..:|..||        .|..     ....|..|:.||: :..:|:  .|..|.:||.
Human   657 NLIRAGIPHEHRSKVWKWCVDRHTRKFK-----DNTEPGHFQTLLQ-KALEKQNPASKQIELDLL 715

  Fly   120 RTFPDNIHFDMKK----QRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIV 180
            ||.|:|.|:....    |:|.|:|:|::..|.|:|||||||.:..:.|:..:.|: :||.|..||
Human   716 RTLPNNKHYSCPTSEGIQKLRNVLLAFSWRNPDIGYCQGLNRLVAVALLYLEQED-AFWCLVTIV 779

  Fly   181 ENIVPQ-YHSHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVET 244
            |..:|: |::..:.....|..|||:|:..::|.::.|.:...:.|.:|...||:.:|.:.:..:.
Human   780 EVFMPRDYYTKTLLGSQVDQRVFRDLMSEKLPRLHGHFEQYKVDYTLITFNWFLVVFVDSVVSDI 844

  Fly   245 VLRIWDCVFAEGYKIVFRAALTMFVTHKNAILGCDDIAALANLFRDTMIQDNIVTDCHGFVEAMF 309
            :.:|||....||.|::||.||.:|...:..||...|   ..::|:........:.|....:...|
Human   845 LFKIWDSFLYEGPKVIFRFALALFKYKEEEILKLQD---SMSIFKYLRYFTRTILDARKLISISF 906

  Fly   310 --------------------SLRLKRSELESLRK 323
                                .:||:.:|||::|:
Human   907 GDLNPFPLRQIRNRRAYHLEKVRLELTELEAIRE 940

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 70/223 (31%)
TBC1D2BNP_001374071.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
PH_TBC1D2A 36..144 CDD:269966
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 272..348
Smc <338..552 CDD:224117
RabGAP-TBC 665..876 CDD:366170 65/217 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162786at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100958
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.