DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and TBC1D9B

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_942568.2 Gene:TBC1D9B / 23061 HGNCID:29097 Length:1250 Species:Homo sapiens


Alignment Length:285 Identity:79/285 - (27%)
Similarity:136/285 - (47%) Gaps:28/285 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 AKLKRYIRKGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLRTEPFDKEI-SDSISIDLPRTFPD 124
            ||.:..:.||||...|.::|:..|||.......|..:..|:........: ::.|..||.|:.|:
Human   499 AKTRALVLKGIPESLRGELWLLFSGAWNEMVTHPGYYAELVEKSTGKYSLATEEIERDLHRSMPE 563

  Fly   125 NIHF--DMKKQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVENIVPQY 187
            :..|  ::....|..:|.|||..|..:||||.:|.:..:||:. ..||::||||..:.|.::|.|
Human   564 HPAFQNELGIAALRRVLTAYAFRNPTIGYCQAMNIVTSVLLLY-GSEEEAFWLLVALCERMLPDY 627

  Fly   188 HSHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIAS---KWFICIFAEVLPVETVLRIW 249
            ::..:...|.|..:|.||....:|.::..:.:||    ||:|   .||:.:|..|:|.|:.:.|.
Human   628 YNTRVVGALVDQGIFEELTRDFLPQLSEKMQDLG----VISSISLSWFLTLFLSVMPFESAVVIV 688

  Fly   250 DCVFAEGYKIVFRAALTMFVTHKNAILGCDD---IAALANLFRDTMIQDNIVTDCHGFVEAMFS- 310
            ||.|.||.|::.:.||.:...:...:|||.|   ...:...:.|.::....|:.....:.|:.| 
Human   689 DCFFYEGIKVILQVALAVLDANMEQLLGCSDEGEAMTMLGRYLDNVVNKQSVSPPIPHLRALLSS 753

  Fly   311 -------------LRLKRSELESLR 322
                         |::...:..|||
Human   754 SDDPPAEVDIFELLKVSYEKFSSLR 778

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 65/214 (30%)
TBC1D9BNP_942568.2 PH-GRAM1_TCB1D9_TCB1D9B 153..251 CDD:275420
PH-GRAM2_TCB1D9_TCB1D9B 299..394 CDD:270161
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..443
TBC 505..715 CDD:214540 65/214 (30%)
EFh <855..906 CDD:298682
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 974..999
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1069..1093
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1128..1157
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.