DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and Tbc1d12

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_666064.3 Gene:Tbc1d12 / 209478 MGIID:2384803 Length:698 Species:Mus musculus


Alignment Length:313 Identity:69/313 - (22%)
Similarity:132/313 - (42%) Gaps:54/313 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KTLTRRRMK-----------WEAILQQNTDLTQVDAKLKRYIRKGIPGPYRPDVWMKISGAAAAQ 90
            |.:.:.|.|           |...:..|.::.:...:::....:|:|...|..||....|...  
Mouse   363 KRIMKERFKQEESIASAMVIWINEILPNWEVMRSTRRVRELWWQGLPPSVRGKVWSLAVGNEL-- 425

  Fly    91 RRSPDLFRNLL-----RTEPF---------------DKEIS-DSISIDLPRTFPDNIHFDMK--- 131
            ..:|:|:...|     |.:.|               |:|.| :.|.:|:.|||| :::...|   
Mouse   426 NITPELYEIFLSRAKERWKSFSESSSENDTEGLSVADREASLELIKLDISRTFP-SLYIFQKGGP 489

  Fly   132 -KQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVE---NIVPQYHSHNM 192
             ...|::||.||..:..||||.||:::||. :||:..:|..:|....:::.   .:......|:|
Mouse   490 YHDVLHSILGAYTCYRPDVGYVQGMSFIAA-VLILNLEEADAFIAFANLLNKPCQLAFFRVDHSM 553

  Fly   193 ANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCVFAEGY 257
              :|:..|.|.......:..:..|..:..|...:....|...::::.||::...|:||....:|.
Mouse   554 --MLKYFATFEVFFEENLSKLFLHFKSYNLTPDIYLIDWIFTLYSKSLPLDLACRVWDVFCRDGE 616

  Fly   258 KIVFRAALTMFVTHKNAILGCDDIAALANLFRDTMIQDNIVTDCHGFVEAMFS 310
            :.:||..|.:...:::.:|..|.|.....|   |.:.::|.:      |.:||
Mouse   617 EFLFRTGLGILRLYEDILLQMDFIHIAQFL---TKLPEDITS------EKLFS 660

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 55/236 (23%)
Tbc1d12NP_666064.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..59
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..123
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..236
COG5210 304..639 CDD:227535 61/281 (22%)
RabGAP-TBC 468..635 CDD:278964 41/170 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.