DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and tbc-16

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_508988.3 Gene:tbc-16 / 180856 WormBaseID:WBGene00018639 Length:725 Species:Caenorhabditis elegans


Alignment Length:208 Identity:51/208 - (24%)
Similarity:85/208 - (40%) Gaps:31/208 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 ISDSISIDLPRTFPDNIHF----DMKKQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEE 170
            |.:||..|:.||...|..|    :...:.:.|||:.||....|:.|.||::.:...||....||.
 Worm   469 IENSIVKDVVRTDRKNPFFAGDNNPNSEIMKNILLNYAVMYPDINYIQGMSDLLAPLLSTLKDEV 533

  Fly   171 KSFWLLKHIVENIVPQYHSHNMANLLR-DLAVFRELVIRRIPAVNRHV-----DNLGLPYPVIAS 229
            .|::..|:.::..|.........||:. :|...|.::...:|....|:     |.:.|   :...
 Worm   534 DSYFCFKNFMQQTVFSSTPQGNENLMETNLTYLRNMLRMFVPDFYEHLEKQRPDAMQL---MFVH 595

  Fly   230 KWFICIFAEVLPVETVLRIWDCVFAEGYK--------------IVFRAALTMFVTHKNAILGCDD 280
            :|.:..|....|....|.||:|.:|. |:              |..:..||..:.|...:|   .
 Worm   596 RWILLCFKREFPENYALHIWECCWAH-YRTNYFHLFVCVAIVSIYGKDVLTQDLPHDEILL---F 656

  Fly   281 IAALANLFRDTMI 293
            .|:|||....|::
 Worm   657 FASLANHMDATLV 669

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 45/189 (24%)
tbc-16NP_508988.3 DUF3548 32..>136 CDD:371881
TBC 415..644 CDD:214540 42/178 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.