DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and tbc-12

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_508458.1 Gene:tbc-12 / 180556 WormBaseID:WBGene00044061 Length:614 Species:Caenorhabditis elegans


Alignment Length:273 Identity:64/273 - (23%)
Similarity:116/273 - (42%) Gaps:67/273 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KWEAILQQNTDLTQVDAKLKRYI-RKGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLL--RTEPF 106
            |||.:         .|:|..|.: .:|:|...|.::|....|...  ..:.:|:..|:  ..|..
 Worm   281 KWEEM---------KDSKRCRELWWQGVPAKVRGELWFLTIGNQI--EITKELYDGLMDQAEEKI 334

  Fly   107 DKEISD--------------SISIDLPRTF-------PDNIHFDMKKQRLYNILIAYAHHNRDVG 150
            .|::::              .|.:|..|||       .|..::|    .|..:|.|||....|:|
 Worm   335 AKQLAEQNKNSAERKETSVTQIHLDATRTFTSLGMFQKDGPYYD----HLLKLLSAYAILRPDIG 395

  Fly   151 YCQGLNYIAGLLLIVTD--------------DEEKSFWLLKHIVENIVPQYHSHNMANLLRDLAV 201
            |.|.:.:||.:|||..|              ..:.:|:.||.      ||...:.:|        
 Worm   396 YVQSMTFIAAVLLIQMDPYPAFISFANLLDRSLQSAFFGLKQ------PQMTEYFIA-------- 446

  Fly   202 FRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCVFAEGYKIVFRAALT 266
            :...:.:.:||:::|:|.|.:...:...:|...::|:.||::...||||..|.:|.:.:|:|||.
 Worm   447 YDRYLEQELPALHQHLDKLDVRPDLYLIEWTFAMYAKSLPLDVTCRIWDVYFRDGEEFLFKAALG 511

  Fly   267 MFVTHKNAILGCD 279
            :...::..:|..|
 Worm   512 ILRMYEPKLLTMD 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 56/246 (23%)
tbc-12NP_508458.1 TBC 295..521 CDD:214540 56/245 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.