DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and tbc-11

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_508178.2 Gene:tbc-11 / 180444 WormBaseID:WBGene00018075 Length:934 Species:Caenorhabditis elegans


Alignment Length:298 Identity:80/298 - (26%)
Similarity:132/298 - (44%) Gaps:44/298 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 WEAILQ---QNTDLTQVDAKLKRYIRKGIPGPYRPDVWMKISGAAAAQRRSPDLFR--NLLRTEP 105
            |:.:::   |.:|..|   |:...:..|||...|..||..:|.........|||..  ::..::|
 Worm   398 WDQLIENWDQQSDRPQ---KISELVLDGIPDKLRGRVWQLLSNVRILAIDQPDLVEKYHIFLSQP 459

  Fly   106 FDKEISDSISIDLPRTFPDNIHFDMK----KQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVT 166
            ...|  ..|..|:.||||.:.:|...    :|.||.|...|:.::.:|.|||||:::|..||:..
 Worm   460 CPSE--QVIMRDIHRTFPAHDYFKESQGKGQQSLYKISKVYSLYDEEVSYCQGLSFLAASLLLHM 522

  Fly   167 DDEEKSFWLLKHIVENIVPQYHSHNMANLLRDL--AVFRELVIR----------RIPAVNRHVDN 219
             .||::|..|..|:.|..           ||||  ..|..|.:|          .||.::.|:::
 Worm   523 -PEEQAFCTLVKIMFNYG-----------LRDLFKLGFDNLHLRFFQLTALLKDYIPDLSHHLEH 575

  Fly   220 LGLPYPVIASKWFICIFAEVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTHKNAILGCDDIAAL 284
            :|:...:.||:||:.:|....|::.|..|.|...::|...:|..:|.:....|..:|..|....|
 Worm   576 IGIETHMYASQWFLTLFTAKFPLQMVFFILDLFLSQGMNTIFHISLALLDDAKTDLLQLDFEGTL 640

  Fly   285 ANLFRDTM---IQDNIVTDCHGFVEAMFSLRLKRSELE 319
             ..||.::   .:....|.|  .:......||..|:||
 Worm   641 -KYFRVSLPRKYRTEASTKC--LIHKAVKFRLNHSKLE 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 63/226 (28%)
tbc-11NP_508178.2 PH-like 11..147 CDD:388408
DUF3694 183..293 CDD:372133
TBC 419..632 CDD:214540 63/226 (28%)
Smc <697..>901 CDD:224117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.