DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and tbc-9

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_502598.2 Gene:tbc-9 / 178316 WormBaseID:WBGene00012868 Length:1247 Species:Caenorhabditis elegans


Alignment Length:268 Identity:88/268 - (32%)
Similarity:136/268 - (50%) Gaps:20/268 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RMKWEAILQQ-NTDLTQV-DAKLKRYIRKGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLRTEP 105
            |.||...||: .|.:... ..:|.|.:.:|:|...|..:||..|||||....:|..:|.||....
 Worm   460 REKWNKYLQEYGTGVCMYRTVELHRLLLEGVPLQLRGQIWMVCSGAAAEMALNPGYYRELLHKNQ 524

  Fly   106 FDKEIS-DSISIDLPRTFPDNIHFDMKK--QRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTD 167
            ....:: :.|..||.|:.|::..|....  ..|..||.|||..|.::||||.:|.:..:||:.|.
 Worm   525 GVYSVALEEIERDLHRSLPEHPAFQQGPGIDALRRILTAYAFRNPNIGYCQAMNIVGSVLLLFTK 589

  Fly   168 DEEKSFWLLKHIVENIVPQYHSHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWF 232
            :|| :||||..:.|.::|.|::..:...|.|..||.|||.|.:|.|...:..|||. .::|..||
 Worm   590 EEE-AFWLLVAVCERLLPDYYNTKVVGALVDQGVFSELVERLLPTVGAQLTRLGLD-DMVALSWF 652

  Fly   233 ICIFAEVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTHKNAILGC---DDIAALANLFR----- 289
            :.:|...:..:..:||.|..|.||.:::|:.||.|.  .:|..|.|   ||...|.:|.:     
 Worm   653 LTVFLSAIKFDAAVRILDLFFFEGARLMFQVALEML--KENEKLICESRDDGEILMSLAKYTESI 715

  Fly   290 ---DTMIQ 294
               ||:::
 Worm   716 YEGDTVVE 723

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 72/211 (34%)
tbc-9NP_502598.2 PH-GRAM1_TCB1D9_TCB1D9B 154..253 CDD:275420
PH-GRAM2_TCB1D9_TCB1D9B 309..406 CDD:270161
TBC 489..695 CDD:214540 72/209 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.