DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and tbc-8

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001255072.1 Gene:tbc-8 / 176454 WormBaseID:WBGene00008018 Length:913 Species:Caenorhabditis elegans


Alignment Length:350 Identity:81/350 - (23%)
Similarity:134/350 - (38%) Gaps:82/350 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VDEYGFK--RGDHFDYNN-------YSKFMDGYLKTLTRRRMKW-------------EAILQQNT 54
            |||..:|  |.:..:.|.       |.:.::| :.|...|||.|             |:.|:|.|
 Worm   565 VDEKFWKQARAEPTEENEKEFLKRVYWRGIEG-INTKEVRRMAWPYLLGLFEWNESPESRLEQFT 628

  Fly    55 DLTQVDAK----LKRYIRKGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLRTEP-----FDKEI 110
            .....|.:    |:..:|:.....:|.....|  .|:..:..|.|:|.:  ..||     :|:| 
 Worm   629 SQYWQDIEEWRVLEAEVRRRDEEAFRAARARK--AASPVREESCDVFED--PNEPTCSQHYDRE- 688

  Fly   111 SDSISIDLPRTFPDNIH---------------FDMKK--QRLYNILIAYAHHNRDVGYCQGLNYI 158
                  :|...|..|:|               |..|.  :.|..::..|...|.:.||.||:..:
 Worm   689 ------NLITLFRANLHRIDKDVERCDRNLMFFSNKDNLESLRRVMYTYVRRNLEEGYTQGMCDL 747

  Fly   159 AGLLLIVTDDEE---KSFWLLKHIVENIVPQYHSHNMANLLRDLAVFRELVIRRIPAVNRHVDNL 220
            ...||:..:||.   :.|.||........||  ...|:..|.:|....::|..:|.|:...:|..
 Worm   748 LAPLLVTFEDEALTLECFSLLMLRQRGKFPQ--RPGMSKCLLNLRSLIQVVDPQIYALISDIDYA 810

  Fly   221 -GLPYPVIASKWFICIFAEVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTHKNAILGCDDIAAL 284
             .|.:   |.:||:..|...|..|...::|:.::         ||..:.:|...||.  ..:|.:
 Worm   811 QALSF---AFRWFLLDFKRELSYECTYKVWEVIW---------AAQRLRITDDFAIF--FGLATI 861

  Fly   285 ANLFRDTMIQDNI-VTDCHGFVEAM 308
            .| :.|.:|.:|. .||...|...|
 Worm   862 TN-YHDVLITNNFDYTDMIKFFNEM 885

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 52/234 (22%)
tbc-8NP_001255072.1 RUN 177..237 CDD:214736
PH_RUTBC 299..467 CDD:275431
TBC 670..869 CDD:214540 51/224 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.