DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and tbc-14

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001317776.1 Gene:tbc-14 / 174986 WormBaseID:WBGene00008444 Length:630 Species:Caenorhabditis elegans


Alignment Length:232 Identity:48/232 - (20%)
Similarity:97/232 - (41%) Gaps:48/232 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RRMKWEAIL------QQNTDLTQVDAKL-KRY--IRKGIPGPYRPDVWMKISGAAAAQRRSPDLF 97
            |:..|:.:|      :.:||.....|:| |:|  ::|         .||.::     :.:.....
 Worm   329 RKEAWKCLLGYRQWHESDTDFQTRRAELAKQYENMKK---------QWMSVT-----EDQEKRFT 379

  Fly    98 RNLLRTEPFDKEISDSISIDLPRTFP-----DNIHFDMKKQRLYNILIAYAHHNRDVGYCQGLNY 157
            :.:.|....:|:::.:     .||.|     ||::.    ..|:|:|:.|..:|.|:||.||::.
 Worm   380 KFVKRKSLVEKDVART-----DRTVPFFQGDDNVNL----VHLHNVLMTYVMYNFDLGYVQGMSD 435

  Fly   158 IAGLLLIVTDDEEKSFWLLKHIVENIVPQYHSHN-----MANLLRDLAVFRELVIRRIPAVNRHV 217
            .|..||.|..||..:||....::|.....:.:..     ..|.||||.    ::|.  |.:..::
 Worm   436 FASPLLFVMKDEVDTFWCFVGLMELTQKNFETDQAFIKLQMNQLRDLV----MIIN--PKLANYL 494

  Fly   218 DNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCVFA 254
            ::..........:|.:..|..........::|:.:::
 Worm   495 ESEKSDDMYFCFRWVLVWFKREFSFLDTCKLWEVLWS 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 39/198 (20%)
tbc-14NP_001317776.1 DUF3548 51..197 CDD:371881
TBC 320..555 CDD:214540 48/232 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.