DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and TBC1D16

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_024306344.1 Gene:TBC1D16 / 125058 HGNCID:28356 Length:824 Species:Homo sapiens


Alignment Length:351 Identity:73/351 - (20%)
Similarity:125/351 - (35%) Gaps:115/351 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RRMKWEAILQQNTDLTQVDAKLKRYIRK-----GIPGPYRPDVWMKISGAAAAQRRSPDLFRNLL 101
            :|:...|.|....:|.||:.:.|  :||     ||....|.:||..:....:.:..|.:  |..|
Human   394 KRLGVSAWLNHLNELGQVEEEYK--LRKAIFFGGIDVSIRGEVWPFLLRYYSHESTSEE--REAL 454

  Fly   102 RTEPFDKEISD------SISIDLPRTFPDNIHFDMKK--------------------QRLYNILI 140
            |.:. .||.|:      |::.:..|.|..|:.|.:.|                    :.:..||:
Human   455 RLQK-RKEYSEIQQKRLSMTPEEHRAFWRNVQFTVDKDVVRTDRNNQFFRGEDNPNVESMRRILL 518

  Fly   141 AYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVEN----------------------- 182
            .||.:|..|||.||::.:...:|....||..:||....:::|                       
Human   519 NYAVYNPAVGYSQGMSDLVAPILAEVLDESDTFWCFVGLMQNTIFVSSPRDEDMEKQLEEWTWET 583

  Fly   183 -------------------IVPQYHS-------HNMA--------NLLRDLAVFRELVIRRIPAV 213
                               ::|:..:       |..|        |..|.| ..|||:  |:..|
Human   584 APKCALRVGSLPGHGAAASVLPRPGTTLCLTLDHTTASGTVRSGRNWQRQL-YLRELL--RLTHV 645

  Fly   214 N--RHVDNLGLP--YPVIASKWFICIFAEVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTHKNA 274
            .  :|:.:||..  ..:...:|.:..|....|....||||:..:|......|.    :|:     
Human   646 RFYQHLVSLGEDGLQMLFCHRWLLLCFKREFPEAEALRIWEACWAHYQTDYFH----LFI----- 701

  Fly   275 ILGCDDIAALANLFRDTMIQDNIVTD 300
               |   .|:..::.|.:|:..:.||
Human   702 ---C---VAIVAIYGDDVIEQQLATD 721

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 60/300 (20%)
TBC1D16XP_024306344.1 TBC 424..709 CDD:214540 60/305 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.