DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and TBC1D8

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_005263919.1 Gene:TBC1D8 / 11138 HGNCID:17791 Length:1162 Species:Homo sapiens


Alignment Length:235 Identity:76/235 - (32%)
Similarity:122/235 - (51%) Gaps:12/235 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KLKRYIRKGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLRTEPFDK--EISDSISIDLPRTFPD 124
            |:::.:..|||...|..:|:..|.|.......|..:.||:. |...|  .:::.|..||.|:.|:
Human   519 KIRKLVAMGIPESLRGRLWLLFSDAVTDLASHPGYYGNLVE-ESLGKCCLVTEEIERDLHRSLPE 582

  Fly   125 NIHFDMKK--QRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVENIVPQY 187
            :..|..:.  ..|..:|.||||.|..:||||.:|.:..:||:.|.:|| :||||..:.|.::|.|
Human   583 HPAFQNETGIAALRRVLTAYAHRNPKIGYCQSMNILTSVLLLYTKEEE-AFWLLVAVCERMLPDY 646

  Fly   188 HSHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCV 252
            .:|.:.....|.:||.||:...:|.:..|:::|.....|..| ||:.:|..::|:|:.:.:.||.
Human   647 FNHRVIGAQVDQSVFEELIKGHLPELAEHMNDLSALASVSLS-WFLTLFLSIMPLESAVNVVDCF 710

  Fly   253 FAEGYKIVFRAALTMFVTHKNAILGC---DDIAALANLFR 289
            |.:|.|.:|:..|.  |...||...|   ||..||..|.|
Human   711 FYDGIKAIFQLGLA--VLEANAEDLCSSKDDGQALMILSR 748

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 68/212 (32%)
TBC1D8XP_005263919.1 PH-GRAM1_TBC1D8 178..276 CDD:270156
PH-GRAM2_TBC1D8 318..413 CDD:270160
TBC 527..733 CDD:214540 68/210 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.