DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and TBC1D7-LOC100130357

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001305738.1 Gene:TBC1D7-LOC100130357 / 107080638 -ID:- Length:293 Species:Homo sapiens


Alignment Length:263 Identity:51/263 - (19%)
Similarity:92/263 - (34%) Gaps:77/263 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 IPGPYRPDVWMKISGAAAAQRRS--------PDLFRNLLRTEPFDKEISDSI------------- 114
            :|..||..||..:.|.......|        .:.:.::|......:.:||:.             
Human    51 LPSMYRALVWKVLLGILPPHHESHAKVMMYRKEQYLDVLHALKVVRFVSDATPQAEVYLRMYQLE 115

  Fly   115 SIDLPRT-----FPDNIHFDMKKQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFW 174
            |..|||:     .||:           .:.:|                ||..:..:.:|....:|
Human   116 SGKLPRSPSFPLEPDD-----------EVFLA----------------IAKAMEEMVEDSVDCYW 153

  Fly   175 LLKHIVENIVPQYHSHNMANLLRDLAVFRELV-------IRRIPAVNRHVDNLGLPYPVIASKWF 232
            :.:..|..:..:|.. ::..|.:....:..|.       :|...|..:      |||.:    ||
Human   154 ITRRFVNQLNTKYRD-SLPQLPKAFEQYLNLEDGRLLTHLRMCSAAPK------LPYDL----WF 207

  Fly   233 ICIFAEVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTHKNAILGCDDIAALANLFRDTMIQDNI 297
            ...||..||..::.|:||.|.:...||:...|:.:.:|.|..::      ||.:..:.|...:||
Human   208 KRCFAGCLPESSLQRVWDKVVSGSCKILVFVAVEILLTFKIKVM------ALNSAEKITKFLENI 266

  Fly   298 VTD 300
            ..|
Human   267 PQD 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 45/237 (19%)
TBC1D7-LOC100130357NP_001305738.1 RabGAP-TBC <147..251 CDD:321955 26/114 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.