DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and tbc1d10c

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_005173203.1 Gene:tbc1d10c / 101887140 ZFINID:ZDB-GENE-130125-1 Length:1383 Species:Danio rerio


Alignment Length:330 Identity:84/330 - (25%)
Similarity:148/330 - (44%) Gaps:46/330 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DVDEYGFKRGDHFDYNNYSKFMDGYLKTLTRRR--------MKWEAILQQNTDLTQVDAKLKRYI 67
            :.:.:||..|      |.....:|....|.|.|        .:||.::::.:.      |:|...
Zfish    23 ETNRFGFIIG------NGETDSEGPCPELVRHRESKWLGLMTQWEQVMEKKSH------KVKSQC 75

  Fly    68 RKGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLRTEPFDKEISDSISIDLPRTFPDNIHFDMK- 131
            :||||...|...|..:.||...:.::..|:.:|:.. |..:...:.|..|..|.||.:..|..| 
Zfish    76 QKGIPASVRIKCWPLLCGAKDRKEKNSTLYNSLVEA-PDHQGWIEIIKRDTDRQFPFHEMFLSKD 139

  Fly   132 ---KQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVENIVPQYHSHNMA 193
               ::.|..:|.||..:..|.||||....:|.:||:....|| :||.|..|.|..:|.|:|..:.
Zfish   140 GHGQKDLLEVLKAYTQYRPDEGYCQAQGPVAAVLLMNMPAEE-AFWCLVQISELYLPGYYSPLLE 203

  Fly   194 NLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCVFAEGYK 258
            .:|.|.||...::.:..||.::|:...|:...:.|:.|.:|:|:..||..|:||:||..|..|.:
Zfish   204 GVLFDAAVLSSVLKKLCPAAHKHLQGQGVEPLMFATDWLMCLFSRHLPFNTLLRVWDLFFCYGVR 268

  Fly   259 IVFRAALTMFVTHKNAILGCDDIAALANLFRDTMIQDNIVTDCHGFVEAMFSLRLKRSELESLRK 323
            ::|:.|:.                    |.|..:....:..:|.|.:|.:..||..:..:::.:.
Zfish   269 VLFQVAVV--------------------LVRRCLGDGRLRKECDGQMETLERLRSVKQRVQNEQT 313

  Fly   324 VAVLN 328
            .|.:|
Zfish   314 DAFIN 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 63/212 (30%)
tbc1d10cXP_005173203.1 TBC 77..278 CDD:214540 63/222 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.