DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and TBC1D3K

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_006722298.1 Gene:TBC1D3K / 101060351 HGNCID:51245 Length:610 Species:Homo sapiens


Alignment Length:289 Identity:70/289 - (24%)
Similarity:117/289 - (40%) Gaps:17/289 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RRMKWEAILQQNTDLTQVDAKLKRYIRKGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLRTEPF 106
            |:.||..:| .:.:..:...||.....||:|...|..:|..:......:.::|..::.:......
Human   135 RKSKWVDML-GDWEKYKSSRKLIDRAYKGMPMNIRGPMWSVLLNIEEMKLKNPGRYQIMKEKGKK 198

  Fly   107 DKEISDSISIDLPRTFPDNIHF----DMKKQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTD 167
            ..|....|..|:..|...:|.|    ..|::.|.:||:||..:|.:||||:.|::||.|.|:.. 
Human   199 SSEHIQRIDRDVSGTLRKHIFFRDRYGTKQRELLHILLAYEEYNPEVGYCRDLSHIAALFLLYL- 262

  Fly   168 DEEKSFWLLKHIV---ENIVPQYHSHNMANL--LRDLAVFRELVIRRIPAVNRHVDNLGLPYPVI 227
            .||.:||.|..::   .:.:..:||.|...:  |:|..  ..:|....|....|.|...|.....
Human   263 PEEDAFWALVQLLASERHSLQGFHSPNGGTVQGLQDQQ--EHVVATSQPKTMGHQDKKDLCGQCS 325

  Fly   228 ASKWFICIFAEVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTHKNAIL---GCDDIAALANLFR 289
            .....|.|..:.:.:...||:||....||.:.:.......|...:..:.   .|...|...|.|.
Human   326 PLGCLIRILIDGISLGLTLRLWDVYLVEGEQALMPITRIAFKVQQKRLTKTSRCGPWARFCNRFV 390

  Fly   290 DTMIQDNIVTDCHGFVEAMFSLRLKRSEL 318
            ||..:|......| ...:|..|..|:.:|
Human   391 DTWARDEDTVLKH-LRASMKKLTRKKGDL 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 52/217 (24%)
TBC1D3KXP_006722298.1 TBC 160..373 CDD:214540 52/215 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.