DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and tbc1d10b

DIOPT Version :10

Sequence 1:NP_650524.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_002940627.3 Gene:tbc1d10b / 100493619 XenbaseID:XB-GENE-940041 Length:1337 Species:Xenopus tropicalis


Alignment Length:325 Identity:102/325 - (31%)
Similarity:151/325 - (46%) Gaps:44/325 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ASSKFSD----------VDEYGFKRGDHFDYNNYSKFMDGYLKT-LTRRR-MKW-EAILQQNTDL 56
            |||..||          .|:|||..|     |.||...:|:|.. ::|:| :|| :.....:..|
 Frog   811 ASSLGSDSEINGIPYRKTDKYGFLGG-----NQYSGNGEGFLSVEISRQRELKWLDMFSHWDKWL 870

  Fly    57 TQVDAKLKRYIRKGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLRTEPFDKEISDSISIDLPRT 121
            ::...|:|...|||||...|...|..:|.:....|::|..|..:.| :|.|.:..|.|..||.|.
 Frog   871 SRRFQKVKLRCRKGIPSSLRAKAWQLLSNSEELLRKNPGKFEEMER-QPGDPKWLDVIEKDLHRQ 934

  Fly   122 FPDNIHFDMK----KQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVEN 182
            ||.:..|..:    :|.||.||.||..:..:.||||....:|.:||:.. ..|::||.|..|.:.
 Frog   935 FPFHEMFAARGGHGQQDLYRILKAYTVYRPEEGYCQAQAPVAAVLLMHM-PAEQAFWCLVQICDK 998

  Fly   183 IVPQYHSHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLR 247
            .:|.|:|..:..:..|..:|..|:.|..|...||:....:...:..::||:|||:..||..:|||
 Frog   999 YLPGYYSAGLEAIQLDGEIFFALLRRVCPMAYRHLKKFKIDPILYMTEWFMCIFSRTLPWASVLR 1063

  Fly   248 IWDCVFAEGYKIVFRAALTMFVTHKNAILGCDDIAALANLFRDTMIQDNIVTDCHGFVEAMFSLR 312
            :||..|.||.|||||..|.                    |.:.|:...:.:..|.|..|.|..||
 Frog  1064 VWDMFFCEGIKIVFRVGLV--------------------LLKHTLGSVDKLRSCQGMYETMEKLR 1108

  Fly   313  312
             Frog  1109  1108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_650524.1 TBC 67..276 CDD:214540 72/212 (34%)
tbc1d10bXP_002940627.3 PLN03131 <505..>698 CDD:178677
TBC 881..1086 CDD:214540 73/226 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.