DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and tbc1d10b

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_002940627.3 Gene:tbc1d10b / 100493619 XenbaseID:XB-GENE-940041 Length:1337 Species:Xenopus tropicalis


Alignment Length:325 Identity:102/325 - (31%)
Similarity:151/325 - (46%) Gaps:44/325 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ASSKFSD----------VDEYGFKRGDHFDYNNYSKFMDGYLKT-LTRRR-MKW-EAILQQNTDL 56
            |||..||          .|:|||..|     |.||...:|:|.. ::|:| :|| :.....:..|
 Frog   811 ASSLGSDSEINGIPYRKTDKYGFLGG-----NQYSGNGEGFLSVEISRQRELKWLDMFSHWDKWL 870

  Fly    57 TQVDAKLKRYIRKGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLRTEPFDKEISDSISIDLPRT 121
            ::...|:|...|||||...|...|..:|.:....|::|..|..:.| :|.|.:..|.|..||.|.
 Frog   871 SRRFQKVKLRCRKGIPSSLRAKAWQLLSNSEELLRKNPGKFEEMER-QPGDPKWLDVIEKDLHRQ 934

  Fly   122 FPDNIHFDMK----KQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVEN 182
            ||.:..|..:    :|.||.||.||..:..:.||||....:|.:||:.. ..|::||.|..|.:.
 Frog   935 FPFHEMFAARGGHGQQDLYRILKAYTVYRPEEGYCQAQAPVAAVLLMHM-PAEQAFWCLVQICDK 998

  Fly   183 IVPQYHSHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLR 247
            .:|.|:|..:..:..|..:|..|:.|..|...||:....:...:..::||:|||:..||..:|||
 Frog   999 YLPGYYSAGLEAIQLDGEIFFALLRRVCPMAYRHLKKFKIDPILYMTEWFMCIFSRTLPWASVLR 1063

  Fly   248 IWDCVFAEGYKIVFRAALTMFVTHKNAILGCDDIAALANLFRDTMIQDNIVTDCHGFVEAMFSLR 312
            :||..|.||.|||||..|.                    |.:.|:...:.:..|.|..|.|..||
 Frog  1064 VWDMFFCEGIKIVFRVGLV--------------------LLKHTLGSVDKLRSCQGMYETMEKLR 1108

  Fly   313  312
             Frog  1109  1108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 72/212 (34%)
tbc1d10bXP_002940627.3 PSII_BNR 155..471 CDD:421885
PLN03131 <505..>698 CDD:178677
TBC 881..1086 CDD:214540 73/226 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.