DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and tbc1d2b

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_002666912.2 Gene:tbc1d2b / 100330777 ZFINID:ZDB-GENE-100922-148 Length:946 Species:Danio rerio


Alignment Length:357 Identity:100/357 - (28%)
Similarity:166/357 - (46%) Gaps:51/357 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SDVDEYGFK-----RGDHFDYNNYSKFMDGYLKTL------TRRRMKWEAIL--QQNTDLTQVDA 61
            |:.|.||||     ..:........:.:|  ||:|      |..|:||:..|  ..|.::.: ..
Zfish   575 SEYDIYGFKTVPEEEDEEEKLEAKKRALD--LKSLSLTDQETSVRVKWDNYLAITMNREMVR-SP 636

  Fly    62 KLKRYIRKGIPGPYRPDVWMKISGAAAAQRRS---PDLFRNLL-----RTEPFDKEISDSISIDL 118
            .||..:|.|:|..:|..||.........:.|.   .|.:.|||     :..|..|:    |.:||
Zfish   637 DLKALMRGGVPHIHRSKVWSWCVSFHVKKMRDCQPKDYYHNLLCMANDKPNPACKQ----IELDL 697

  Fly   119 PRTFPDNIHFDMKK----QRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHI 179
            .||.|:|.|:....    |:|.|:|:|::..|.|:|||||||.:|.:.|:..|.|: :||.|..|
Zfish   698 LRTLPNNKHYSSPDSDGIQKLRNVLLAFSWRNPDIGYCQGLNRLAAIALLYLDQED-AFWCLVAI 761

  Fly   180 VENIVP-QYHSHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVE 243
            ||..:| .|::..:.....|..||::|:..::|.::.|.::..:.:.:|...||:.:|.:.:..:
Zfish   762 VEVFMPHDYYTKTLLGSQVDQRVFKDLMYEKLPRLHAHFEHYKVDFSLITFNWFLVVFVDSVVSD 826

  Fly   244 TVLRIWDCVFAEGYKIVFRAALTMFVTHKNAILGCDDIAALANLFR--DTMIQDNIVTDCHGFVE 306
            .:.:|||....||.||:||.||.:|...:...|...|...:....|  ...|.|........||:
Zfish   827 ILFKIWDSFLYEGPKIIFRFALALFKYKEEEFLKLQDPMTIFKYLRYFTRTILDARKLMAMAFVD 891

  Fly   307 A---------------MFSLRLKRSELESLRK 323
            .               :..:||:.:|||::|:
Zfish   892 MNPFPLRQIQNRRTFHLEKVRLELTELEAIRQ 923

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 69/221 (31%)
tbc1d2bXP_002666912.2 PH_TBC1D2A 37..137 CDD:269966
PH 37..129 CDD:278594
CtIP_N 307..415 CDD:287457
TPR_MLP1_2 313..434 CDD:285204
USP8_interact 317..>359 CDD:286082
TBC 643..859 CDD:214540 69/220 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162786at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100958
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.