DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and sgsm3

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001123837.1 Gene:sgsm3 / 100170594 XenbaseID:XB-GENE-965522 Length:753 Species:Xenopus tropicalis


Alignment Length:330 Identity:93/330 - (28%)
Similarity:163/330 - (49%) Gaps:39/330 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DEYGFKRGDHFD--YNNYSKFMDGYLKTLTRRRMKWEAILQ--QNTDL-----TQVDA------K 62
            ||:|| |.|..|  ..|.||.:...|....::|::|:|.|:  .|.|:     .::|.      |
 Frog    44 DEFGF-RVDKEDGAEPNSSKLLGIPLTEDPQQRLRWQAHLEFTHNHDVGDLTWDKIDVTLPHSDK 107

  Fly    63 LKRYIRKGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLRTEPFDKEI-SDSISIDLPRTFPDNI 126
            |:..:..|||...||.:||::|||...::.|...:::::|....|..: :..|..||.||.|.|.
 Frog   108 LRSLVLAGIPHSMRPQLWMRLSGALQKKQNSEMTYKDIVRNSSNDDTLAAKQIEKDLLRTMPSNA 172

  Fly   127 HFDMKKQ----RLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVENIVP-Q 186
            .|...:.    ||..:|...|....|:|||||...:|..||:.. :||.:||::..|||::|| .
 Frog   173 CFSNLQSVGVPRLRRVLRGLAWLYPDIGYCQGTGMVAACLLLFL-EEEDAFWMMAAIVEDLVPVS 236

  Fly   187 YHSHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDC 251
            |.:..:..:..|..|.|.|:::.:|.:::.:....:...:|...||:..||.|:.::.:|||||.
 Frog   237 YFNTTLVGVQTDQRVLRHLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVHIKLLLRIWDF 301

  Fly   252 VFAEGYKIVFRAALTMFVTHKNAILGCDDIAALAN--------------LFRDTMIQDNIVTDCH 302
            .|.:|..::|:..|.|....:..::..::.|::.|              |.|:.|:....:|:. 
 Frog   302 FFYQGSLVLFQTTLGMLKMKEEELIQSENSASIFNTLSDIPSQIEEADVLLREAMLISGTLTEV- 365

  Fly   303 GFVEA 307
             .:||
 Frog   366 -MIEA 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 65/214 (30%)
sgsm3NP_001123837.1 TBC 115..326 CDD:214540 65/211 (31%)
SH3_SGSM3 486..538 CDD:212747
RUN 565..716 CDD:367169
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1162786at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.