DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and tbc1d9b

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001107313.1 Gene:tbc1d9b / 100135104 XenbaseID:XB-GENE-989754 Length:1259 Species:Xenopus tropicalis


Alignment Length:339 Identity:85/339 - (25%)
Similarity:161/339 - (47%) Gaps:57/339 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GYLKTLTRR-----RMKW--EAILQQNTDLTQVD----------AKLKRYIRKGIPGPYRPDVWM 81
            |.||...|.     :.||  |.:.:::.::..::          :|.:..:.||||...|.::|:
 Frog   454 GLLKLFQREITEDMKPKWDKEKMKEESWNIHFLEYGRGMCMYRTSKTRELVLKGIPENLRGELWL 518

  Fly    82 KISGAAAAQRRSPDLFRNLLRTEPFDKEI------SDSISIDLPRTFPDNIHF--DMKKQRLYNI 138
            ..|||:......|..:.:|:     :|.:      :|.|..||.|:.|::..|  ::....|..:
 Frog   519 LFSGASNEMVTHPGYYADLV-----EKSMGRCNLATDEIERDLHRSMPEHPAFQNELGIAALRRV 578

  Fly   139 LIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVENIVPQYHSHNMANLLRDLAVFR 203
            |.|||..|.::||||.:|.:..:||:..::|| :||||..:.|:::|.|::..:...|.|..||.
 Frog   579 LTAYAFRNPNIGYCQAMNIVTSVLLLYCNEEE-AFWLLVSLCEHMLPDYYNTRVVGALVDQGVFE 642

  Fly   204 ELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCVFAEGYKIVFRAALTMF 268
            ||....:|.::..:..||: ...|:..||:.:|..|:|.|:.:.:.||.|.||.|::.:.:|.:.
 Frog   643 ELTRLYLPQLSEKMQELGV-ISTISLSWFLTLFLSVMPFESAVVVVDCFFFEGIKLILQLSLAVL 706

  Fly   269 VTHKNAILGC-DDIAALANLFR--DTMIQDNIVT--------------------DCHGFVEAMFS 310
            ..:..:::.| |:..|:..|.|  |.::....|:                    |....:||.:.
 Frog   707 EANMESLMNCMDEGEAMTILGRYLDNVLNKQSVSPPIPHLHALLTIGDEPPPEVDIFELIEASYE 771

  Fly   311 --LRLKRSELESLR 322
              ..|:..::|.:|
 Frog   772 KFSALRSDDIEQMR 785

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 64/216 (30%)
tbc1d9bNP_001107313.1 PH-GRAM1_TCB1D9_TCB1D9B 154..251 CDD:275420
PH-GRAM2_TCB1D9_TCB1D9B 299..394 CDD:270161
TBC 504..714 CDD:214540 64/216 (30%)
EFh <854..905 CDD:298682
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.