DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5916 and tbc1d8b

DIOPT Version :9

Sequence 1:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001107709.2 Gene:tbc1d8b / 100101803 XenbaseID:XB-GENE-923435 Length:1119 Species:Xenopus tropicalis


Alignment Length:243 Identity:72/243 - (29%)
Similarity:124/243 - (51%) Gaps:18/243 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KLKRYIRKGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLLRTEPFDKEI------SDSISIDLPR 120
            |.:..:.:|||...|.::|:..|||......:|..:     ||..:|.:      :|.|..||.|
 Frog   474 KTRNLVVRGIPETLRGELWLLFSGAVNDMAANPGYY-----TEIVEKSLGTCTLATDEIERDLRR 533

  Fly   121 TFPDNIHF--DMKKQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVENI 183
            :.|::..|  |.....|..:|.|||:.|..:||||.:|.:..:||:...:|| :||||..:.|.:
 Frog   534 SLPEHPAFQSDTGISALRRVLTAYAYRNPKIGYCQAMNILTSVLLLYAKEEE-AFWLLVAVCERM 597

  Fly   184 VPQYHSHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRI 248
            :|.|.:..:...|.|.|||.||:...:|.:..|:.::.. :..::..||:.:|..|||:|:.:.:
 Frog   598 LPDYFNRRIIGALVDQAVFEELIKEYLPLLTSHMTDITF-FSSVSLSWFLTLFISVLPIESAVNV 661

  Fly   249 WDCVFAEGYKIVFRAALTMFVTHKNAILGCDDIA---ALANLFRDTMI 293
            .||.|.:|.|.:.:..|.:...:...:|.|.|.|   .:.|.|.|.::
 Frog   662 VDCFFYDGIKAILQLGLVVLDFNMEKLLACKDDAEAVTILNRFFDNVV 709

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5916NP_001287357.1 TBC 67..276 CDD:214540 64/216 (30%)
tbc1d8bNP_001107709.2 PH-GRAM1_TBC1D8B 155..253 CDD:275419
PH-GRAM2_TBC1D8B 295..387 CDD:270159
TBC 481..689 CDD:214540 64/214 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R540
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.