DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5903 and APOO

DIOPT Version :9

Sequence 1:NP_001287356.1 Gene:CG5903 / 41959 FlyBaseID:FBgn0038400 Length:226 Species:Drosophila melanogaster
Sequence 2:XP_011543886.1 Gene:APOO / 79135 HGNCID:28727 Length:202 Species:Homo sapiens


Alignment Length:137 Identity:42/137 - (30%)
Similarity:57/137 - (41%) Gaps:31/137 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PKPERHPPQDSV------LHKNLEAGVRYVREEVQSGYKAVADQAGIVGHYVE-----------T 99
            ||.: .||::||      |:...|...:|| ||.:|..:....|   :.||.|           .
Human    29 PKKD-SPPKNSVKVDELSLYSVPEGQSKYV-EEARSQLEESISQ---LRHYCEPYTTWCQETYSQ 88

  Fly   100 AKAHTQSTID--------MLNEPQNSLHRSGAIVVGGLAGFIFAARGGFIKKVLYSGIGAGAVAS 156
            .|...||.:.        :.|.|.....|.|.|...||.|.:. |||..|||::|.....|..||
Human    89 TKPKMQSLVQWGLDSYDYLQNAPPGFFPRLGVIGFAGLIGLLL-ARGSKIKKLVYPPGFMGLAAS 152

  Fly   157 MCYPRQA 163
            :.||:||
Human   153 LYYPQQA 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5903NP_001287356.1 ApoO 42..180 CDD:286810 42/137 (31%)
APOOXP_011543886.1 ApoO 45..181 CDD:286810 36/120 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143236
Domainoid 1 1.000 44 1.000 Domainoid score I12312
eggNOG 1 0.900 - - E1_KOG4798
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I5474
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1605767at2759
OrthoFinder 1 1.000 - - FOG0002885
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14564
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.