DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5903 and LOC687056

DIOPT Version :9

Sequence 1:NP_001287356.1 Gene:CG5903 / 41959 FlyBaseID:FBgn0038400 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001128468.1 Gene:LOC687056 / 687056 RGDID:1590113 Length:195 Species:Rattus norvegicus


Alignment Length:189 Identity:44/189 - (23%)
Similarity:74/189 - (39%) Gaps:52/189 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ATMGIMAAVAVKAAPEPQKPASSAADCSLVCRPSELPIY----GSLRKTEPKPERHPPQDSVLHK 66
            |::.::......|..|...|.|..       |.|||.:|    |..:..| ||.      ::|.:
  Rat    12 ASLSLLTFRGYAAPKEDSAPGSYK-------RMSELSLYSVPEGQSKYVE-KPR------TLLEE 62

  Fly    67 NLEAGVRYVREEVQSGYKAVADQAGIVGHYVETAKAHTQSTIDML------------NEPQNSLH 119
            |: :.:|::.|...|.|:.:              .:||:..::.|            |.|...|.
  Rat    63 NI-SQLRHLCEPYTSLYQEM--------------YSHTKPKVEYLVQWGVSNYNHLKNAPPGFLP 112

  Fly   120 RSGAIVVGGLAGFIFAARGGFIKKVLYSGIGAGAVASMCYPRQAEENCRVVLYEGRKIF 178
            |.|.|   |..|.:| |:|..:||::|.....|..||:..|   |:...:....|.|::
  Rat   113 RLGVI---GFVGLLF-AKGSKLKKLVYPPFFMGLGASVSNP---EKVITIAQISGEKLY 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5903NP_001287356.1 ApoO 42..180 CDD:286810 35/153 (23%)
LOC687056NP_001128468.1 ApoO 41..174 CDD:286810 35/153 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.