DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5903 and Apoo

DIOPT Version :9

Sequence 1:NP_001287356.1 Gene:CG5903 / 41959 FlyBaseID:FBgn0038400 Length:226 Species:Drosophila melanogaster
Sequence 2:XP_011245968.1 Gene:Apoo / 68316 MGIID:1915566 Length:230 Species:Mus musculus


Alignment Length:208 Identity:55/208 - (26%)
Similarity:82/208 - (39%) Gaps:47/208 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VKAAPEPQKPASSAADCSLVCRPSELPIYGSLRKTEPKPERHPPQDSVLHKNLEAGVRYVR---- 76
            |.|||:...|..|      ..:..||.:| |:.:.:.|....|      ...||..:..:|    
Mouse    21 VYAAPKKDSPHKS------YMKIDELSLY-SVPEGQSKYVEEP------RTQLEENISQLRHHCE 72

  Fly    77 ------EEVQSGYKAVADQAGIVGHYVETAKAHTQSTIDMLNEPQNS----LHRSGAIVVGGLAG 131
                  :|:.|..|...|      |:|       |..:|..|..||:    ..|.|.|...|..|
Mouse    73 PYTSFCQEIYSHTKPKVD------HFV-------QWGVDNYNYLQNAPPGFFPRLGVIGFAGFVG 124

  Fly   132 FIFAARGGFIKKVLYSGIGAGAVASMCYPRQAEENCRVV---LYE-GRKIFAVAYNFIKG--VKP 190
            .:| |||..|||::|.....|..||:.||:||....::.   ||: |.:.:.|..:..|.  .||
Mouse   125 LLF-ARGSKIKKLVYPPFFMGLGASVYYPQQAITIAQITGEKLYDWGLRGYIVIEDLWKQNFQKP 188

  Fly   191 GEDVPVVPFPTSL 203
            ...:.::..|..|
Mouse   189 CFHIVLIELPVQL 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5903NP_001287356.1 ApoO 42..180 CDD:286810 41/155 (26%)
ApooXP_011245968.1 ApoO 54..177 CDD:370675 38/142 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833412
Domainoid 1 1.000 43 1.000 Domainoid score I12316
eggNOG 1 0.900 - - E1_KOG4798
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I5476
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1605767at2759
OrthoFinder 1 1.000 - - FOG0002885
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14564
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.860

Return to query results.
Submit another query.