DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5903 and apooa

DIOPT Version :9

Sequence 1:NP_001287356.1 Gene:CG5903 / 41959 FlyBaseID:FBgn0038400 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001032192.1 Gene:apooa / 641319 ZFINID:ZDB-GENE-031118-91 Length:205 Species:Danio rerio


Alignment Length:167 Identity:44/167 - (26%)
Similarity:73/167 - (43%) Gaps:31/167 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TATMGIMAAVAVKAAPEPQKPAS--SAADCSLVCRPSELPIYGSLRKTEP-KPERHPPQDSVLHK 66
            :.|:|:.:| :|.||....||.:  |..:.||...|.:        ..:| :.||...::.|   
Zfish    11 SGTLGLFSA-SVLAASADDKPKTTLSVEELSLYSVPQQ--------NIQPVESERGQLEERV--- 63

  Fly    67 NLEAGVRYVREE----VQSGYKAVADQAGIVGHYVETAKAHTQSTIDMLNEPQNSLHRSGAIVVG 127
               |.:|.:.|.    .|..|..|..:......:.:.:.|:      :.|.|.....|:|.|...
Zfish    64 ---AELRLMTEPYLTWCQGAYGTVKPKVDSTVQFGQNSYAY------LKNPPPEFYPRAGIIGFA 119

  Fly   128 GLAGFIFAARGGFIKKVLYSGIGAGAV-ASMCYPRQA 163
            |:.| :|..||..:|:::|. .|..|| |||.||::|
Zfish   120 GILG-LFLGRGSRLKRLIYP-TGLMAVGASMYYPQEA 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5903NP_001287356.1 ApoO 42..180 CDD:286810 32/128 (25%)
apooaNP_001032192.1 ApoO 40..176 CDD:286810 35/137 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576085
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1605767at2759
OrthoFinder 1 1.000 - - FOG0002885
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14564
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.