DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5903 and apool

DIOPT Version :9

Sequence 1:NP_001287356.1 Gene:CG5903 / 41959 FlyBaseID:FBgn0038400 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001014373.1 Gene:apool / 541537 ZFINID:ZDB-GENE-050327-76 Length:457 Species:Danio rerio


Alignment Length:162 Identity:47/162 - (29%)
Similarity:73/162 - (45%) Gaps:17/162 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PSELPIYGSLRKTEPKPERHPPQDSVLHKNLEAGVR-YVREEVQSGYKAVADQAGIVGHYVETAK 101
            |.||.||....:.....|..|........::..|:: ||| .||:|..:|  :.|::..|     
Zfish    38 PRELSIYSPDGRAVQFVEEQPGLVQTGLGSVRVGLQPYVR-AVQNGLTSV--KVGVISLY----- 94

  Fly   102 AHTQSTIDMLNE-PQNSLHRSGAIVVGGLAGFIFAARGGFIKKVLYSGIGAGAVASMCYPRQAEE 165
            ...|.|...|.: |...|.|...|.|.||.|.|.|.:|..:|:::.....|.|..::|||.|...
Zfish    95 QSGQDTYHFLRDPPPGFLPRVTVIGVSGLGGLILARKGSRLKRIVVPLGLASAGTAVCYPTQTVG 159

  Fly   166 NCRVVLYEGRKIFAVA---YNFIKGVKPGEDV 194
            ..::.   |:|:::|:   .:..|. ||.|||
Zfish   160 ALKIT---GKKVYSVSSSVASMFKS-KPKEDV 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5903NP_001287356.1 ApoO 42..180 CDD:286810 37/139 (27%)
apoolNP_001014373.1 ApoO 42..167 CDD:286810 36/135 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576086
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4798
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1605767at2759
OrthoFinder 1 1.000 - - FOG0002885
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108724
Panther 1 1.100 - - O PTHR14564
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.710

Return to query results.
Submit another query.