DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5903 and Apool

DIOPT Version :9

Sequence 1:NP_001287356.1 Gene:CG5903 / 41959 FlyBaseID:FBgn0038400 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001380645.1 Gene:Apool / 317191 RGDID:1549725 Length:265 Species:Rattus norvegicus


Alignment Length:244 Identity:59/244 - (24%)
Similarity:104/244 - (42%) Gaps:60/244 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LRKTATMG---IMAAVAVKAA--PEPQKPASSAADCSLVCRPSELPIYGSLRKTEPKPERHPPQD 61
            :||..||.   |.|::.|..|  .||:|.         :.||.:||||.:           ||  
  Rat     6 MRKLTTMPAGLIYASINVHLAKEEEPKKQ---------LVRPEQLPIYTA-----------PP-- 48

  Fly    62 SVLHKNLEAGVRYVREE---VQSGYKAVADQAGIV-----GHY-------VETAKAHTQSTIDML 111
              ||.      :||.|:   :|.|:.::.......     |.|       ::|.:....:.:.:.
  Rat    49 --LHS------KYVEEQPGYLQRGFTSIRTTTAYYIGWCKGIYLFMKNGVMDTVQIGKDAYVYLK 105

  Fly   112 NEPQNSLHRSGAIVVGGLAGFIFAARGGFIKKVLYSGIGAGAV-ASMCYPRQAEENCRVVLYEGR 175
            |.||:.|.:.|.|...||||.:.|.:|...||:.|. :|...: |::|||.|:....::.   |:
  Rat   106 NPPQDFLPKMGVITASGLAGLLSARKGSRFKKIAYP-LGLATLGATVCYPAQSVIIAKIT---GK 166

  Fly   176 KIFAVAYNFIKGVK----PGEDVPVVPFPTSLEDLKYMASDLYDEAKDL 220
            |.:|.::...:.:|    ...:..::|.|.. |..:....:::.:..||
  Rat   167 KAYATSHQIFQAIKSMWTQSSEKELLPEPKE-ETKEGRPDEIHAKTPDL 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5903NP_001287356.1 ApoO 42..180 CDD:286810 38/153 (25%)
ApoolNP_001380645.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336968
Domainoid 1 1.000 44 1.000 Domainoid score I11970
eggNOG 1 0.900 - - E1_KOG4798
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I5377
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1605767at2759
OrthoFinder 1 1.000 - - FOG0002885
OrthoInspector 1 1.000 - - oto98817
orthoMCL 1 0.900 - - OOG6_108724
Panther 1 1.100 - - O PTHR14564
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.