DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5903 and moma-1

DIOPT Version :9

Sequence 1:NP_001287356.1 Gene:CG5903 / 41959 FlyBaseID:FBgn0038400 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_497275.1 Gene:moma-1 / 175243 WormBaseID:WBGene00019333 Length:201 Species:Caenorhabditis elegans


Alignment Length:125 Identity:36/125 - (28%)
Similarity:63/125 - (50%) Gaps:7/125 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ELPIYGSLRKTEPKPERHPPQDSVLHKNLEAGVRYVREEVQSGYKAVADQAGIVG-HYVETAKAH 103
            :||||.  ....|..::..|::.:   .|:.....:|...:..|..||::..:|. ...:|.||.
 Worm    47 QLPIYA--EDNAPLKQKFLPEEPL---PLQREFATIRIACEQEYDRVAERFKVVDCAMTQTKKAA 106

  Fly   104 TQSTIDMLNEPQNSLHRSGAIVVGGLAGFIFAARGGFIKKVLYSGIGAGAVASMCYPRQA 163
            |:... .|.|...:|.::.||.|||:|||:...:.|.:.::|.:.||...:|:.|||.:|
 Worm   107 TKCNA-YLTEEWTALPKAAAITVGGMAGFVLGLKRGPVGRLLTTTIGLATMAAFCYPIEA 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5903NP_001287356.1 ApoO 42..180 CDD:286810 35/123 (28%)
moma-1NP_497275.1 ApoO 64..165 CDD:286810 30/104 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157509
Domainoid 1 1.000 49 1.000 Domainoid score I7959
eggNOG 1 0.900 - - E1_KOG4798
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I4103
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1605767at2759
OrthoFinder 1 1.000 - - FOG0002885
OrthoInspector 1 1.000 - - oto19302
orthoMCL 1 0.900 - - OOG6_108724
Panther 1 1.100 - - LDO PTHR14564
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3843
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.790

Return to query results.
Submit another query.