DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5903 and apool

DIOPT Version :9

Sequence 1:NP_001287356.1 Gene:CG5903 / 41959 FlyBaseID:FBgn0038400 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001135703.1 Gene:apool / 100216278 XenbaseID:XB-GENE-5819844 Length:310 Species:Xenopus tropicalis


Alignment Length:220 Identity:58/220 - (26%)
Similarity:89/220 - (40%) Gaps:64/220 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RPSELPIYGSLRKTEPKPERHPPQDSVLHKNLEAGVRYVRE--------------EVQSGYKAVA 87
            :|.:|.:|....:.....|.||.:       |::|:..|||              .|::|.:   
 Frog    36 KPIQLSVYSVPAQKSKYIEEHPGR-------LQSGLSSVRETIWPYVVWGKHFCSSVRNGVE--- 90

  Fly    88 DQAGIVGHYVETAKAHTQSTIDMLNEPQNSLHRSGAIVVGGLAGFIFAARGGFIKKVLYSGIGAG 152
                      :|.:....|.:.:.|.|...|.|.|.|.|.||||.:.|.:|..:||:.|. :|..
 Frog    91 ----------DTVQFGKDSYVYLKNPPPEFLARLGIITVSGLAGLVLARKGSRLKKIAYP-LGLT 144

  Fly   153 AVA-SMCYPRQAEENCRVVLY---EGRKIFAVAY-------NFIKGVKPGEDVPVVPFPTSLEDL 206
            .:. |:|||.||      |::   .||||:.|::       :..|.....||.|    .|..|||
 Frog   145 TLGISVCYPTQA------VIFAKLTGRKIYTVSHQTYDTLSSLWKTSIHKEDKP----QTQTEDL 199

  Fly   207 KYMAS----DLY----DEAKDLIFP 223
            |...|    |.|    :|..:.:.|
 Frog   200 KIPVSVTEGDHYQGNQEEVLETLIP 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5903NP_001287356.1 ApoO 42..180 CDD:286810 41/155 (26%)
apoolNP_001135703.1 ApoO 41..178 CDD:370675 42/163 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I11838
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1605767at2759
OrthoFinder 1 1.000 - - FOG0002885
OrthoInspector 1 1.000 - - oto105510
Panther 1 1.100 - - O PTHR14564
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3843
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.050

Return to query results.
Submit another query.