DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sb and prss60.1

DIOPT Version :9

Sequence 1:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_001082915.1 Gene:prss60.1 / 799770 ZFINID:ZDB-GENE-070424-25 Length:387 Species:Danio rerio


Alignment Length:261 Identity:101/261 - (38%)
Similarity:151/261 - (57%) Gaps:14/261 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   525 ISAARSECGVPTLARPETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINENWIATAG 589
            :..:.|:..|..||....|||||.:|..|.||||||:....:.|    |.|||:|||..|:.||.
Zfish    15 VQGSHSQLNVCGLAPLNNRIVGGVNAFDGSWPWQVSLHSPIYGG----HFCGGSLINSEWVLTAA 75

  Fly   590 HCVDDLLISQIRIRVGEYDFSHVQEQLPYIERGVAKKVVHPKYSFLTYEYDLALVKLEQPLEFAP 654
            ||:..:..|.:.:.:|:.....|...  .|.|.|:...|||.|:.||.|.|:||:.|...:.|:.
Zfish    76 HCLPRITTSSLLVFLGKTTQQGVNTY--EINRTVSVITVHPSYNNLTNENDIALLHLSSAVTFSN 138

  Fly   655 HVSPICLPETDSLL-IGMNATVTGWGRLSEGGTLPS--VLQEVSVPIVSNDNCKSMFMRAGRQEF 716
            ::.|:||...:|:. .|.::.:||||.:..|..||:  :|||..:|:|.||.|.:: :.:|.   
Zfish   139 YIRPVCLAAQNSVFPNGTSSWITGWGNIQLGVNLPAPGILQETMIPVVPNDQCNAL-LGSGS--- 199

  Fly   717 IPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANLPGVCTRISKFTPW 781
            :.:..:|||...||:|:||||||||:.:| |...:..:||.|||.|||:...|||.||:|::..|
Zfish   200 VTNNMICAGLLQGGRDTCQGDSGGPMVSK-QCLVWVQSGITSWGYGCADPYSPGVYTRVSQYQSW 263

  Fly   782 I 782
            |
Zfish   264 I 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 95/241 (39%)
Tryp_SPc 544..785 CDD:238113 96/242 (40%)
prss60.1NP_001082915.1 Tryp_SPc 33..264 CDD:214473 95/241 (39%)
Tryp_SPc 34..267 CDD:238113 96/242 (40%)
Somatomedin_B 349..382 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.